eF-site ID 4gsu-A PDB Code 4gsu Chain A click to enlarge Title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains Classification TRANSFERASE Compound Probable conserved lipoprotein LPPS Source Mycobacterium tuberculosis (O53223_MYCTU) Sequence A:  LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIAD RGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGT AVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDN TKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKH IIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPW SVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNT VGGTLPGIDGLGDWNIPWDQWRAGNAKA Description Functional site 1) chain A residue 303 type sequence M description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 2) chain A residue 308 type sequence Y description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 3) chain A residue 318 type sequence Y description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 4) chain A residue 333 type sequence V description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 5) chain A residue 352 type sequence H description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 6) chain A residue 353 type sequence G description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 7) chain A residue 354 type sequence C description BINDING SITE FOR RESIDUE DWZ A 501 source : AC1 8) chain A residue 145 type sequence T description BINDING SITE FOR RESIDUE DWZ B 501 source : AC2 9) chain A residue 354 type SITE sequence C description Binds to carbapenem drug (covalent) => ECO:0000250 source Swiss-Prot : SWS_FT_FI5 10) chain A residue 232 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 235 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 236 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 318 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI4 14) chain A residue 331 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI4 15) chain A residue 356 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI4 16) chain A residue 336 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000255|PROSITE-ProRule:PRU01373, ECO:0000305|PubMed:23103390 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 354 type ACT_SITE sequence C description Nucleophile => ECO:0000255|PROSITE-ProRule:PRU01373, ECO:0000269|PubMed:23103390 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links