eF-site ID 4gsr-A PDB Code 4gsr Chain A click to enlarge Title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains Classification TRANSFERASE Compound Probable conserved lipoprotein LPPS Source Mycobacterium tuberculosis (O53223_MYCTU) Sequence A:  SSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAE KAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVA VNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILT VRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDS STYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQ GHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTL PGIDGLGDWNIPWDQWRAGNAKA Description Functional site 1) chain A residue 214 type sequence H description BINDING SITE FOR RESIDUE EMT A 501 source : AC1 2) chain A residue 215 type sequence F description BINDING SITE FOR RESIDUE EMT A 501 source : AC1 3) chain A residue 252 type sequence E description BINDING SITE FOR RESIDUE EMT A 501 source : AC1 4) chain A residue 254 type sequence I description BINDING SITE FOR RESIDUE EMT A 501 source : AC1 5) chain A residue 160 type sequence D description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 6) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 7) chain A residue 205 type sequence N description BINDING SITE FOR RESIDUE GOL A 502 source : AC2 8) chain A residue 203 type sequence L description BINDING SITE FOR RESIDUE GOL A 503 source : AC3 9) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE GOL A 503 source : AC3 10) chain A residue 330 type sequence Y description BINDING SITE FOR RESIDUE GOL A 503 source : AC3 11) chain A residue 388 type sequence I description BINDING SITE FOR RESIDUE GOL A 503 source : AC3 12) chain A residue 389 type sequence D description BINDING SITE FOR RESIDUE GOL A 503 source : AC3 13) chain A residue 232 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 235 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 236 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 318 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI4 17) chain A residue 331 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI4 18) chain A residue 356 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI4 19) chain A residue 336 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000255|PROSITE-ProRule:PRU01373, ECO:0000305|PubMed:23103390 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 354 type SITE sequence C description Binds to carbapenem drug (covalent) => ECO:0000250 source Swiss-Prot : SWS_FT_FI5 21) chain A residue 354 type ACT_SITE sequence C description Nucleophile => ECO:0000255|PROSITE-ProRule:PRU01373, ECO:0000269|PubMed:23103390 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links