eF-site ID 4gp5-C PDB Code 4gp5 Chain C click to enlarge Title Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W from Thermus thermophilus Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) (COXA_THET8) Sequence C:  KPKGALAVILVLTLTILVFWLGVYAVFFARG Description Functional site 1) chain C residue 11 type sequence V description BINDING SITE FOR RESIDUE HAS A 603 source : AC3 2) chain C residue 31 type sequence F description BINDING SITE FOR RESIDUE OLC B 202 source : BC7 3) chain C residue 33 type sequence R description BINDING SITE FOR RESIDUE OLC B 203 source : BC8 4) chain C residue 22 type sequence F description BINDING SITE FOR RESIDUE OLC C 101 source : CC2 5) chain C residue 25 type sequence G description BINDING SITE FOR RESIDUE OLC C 101 source : CC2 6) chain C residue 29 type sequence V description BINDING SITE FOR RESIDUE OLC C 101 source : CC2 7) chain C residue 32 type sequence A description BINDING SITE FOR RESIDUE OLC C 101 source : CC2 8) chain C residue 18 type sequence T description BINDING SITE FOR RESIDUE OLC C 102 source : CC3 9) chain C residue 4-34 type TRANSMEM sequence KPKGALAVILVLTLTILVFWLGVYAVFFARG description Helical source Swiss-Prot : SWS_FT_FI1

Display surface Download Links