eF-site ID 4goe-A PDB Code 4goe Chain A click to enlarge Title Crystal structure of the SGTA homodimerization domain with a covalent modification of a single C38 Classification PROTEIN BINDING Compound Small glutamine-rich tetratricopeptide repeat-containing protein alpha Source Homo sapiens (Human) (SGTA_HUMAN) Sequence A:  MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETA FGVTVEDSDLAL Description Functional site 1) chain A residue 37 type sequence Q description BINDING SITE FOR RESIDUE BME A 101 source : AC1 2) chain A residue 38 type sequence C description BINDING SITE FOR RESIDUE BME A 101 source : AC1 3) chain A residue 53 type sequence A description BINDING SITE FOR RESIDUE BME A 101 source : AC1 4) chain A residue 54 type sequence L description BINDING SITE FOR RESIDUE BME A 101 source : AC1 5) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE CL A 102 source : AC2 6) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE CL A 102 source : AC2 7) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE CL A 102 source : AC2 8) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE CL A 102 source : AC2

Display surface Download Links