eF-site ID 4gja-AB
PDB Code 4gja
Chain A, B

click to enlarge
Title Crystal structure of renin in complex with NVP-AYL747 (compound 5)
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Renin
Source Homo sapiens (Human) (RENI_HUMAN)
Sequence A:  LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTG
SSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFM
LAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQI
QMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSAD
YVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
B:  LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTG
SSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFM
LAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQI
QMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSAD
YVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
Description (1)  Renin (E.C.3.4.23.15)


Functional site

1) chain A
residue 67
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 1000
source : AC1

2) chain A
residue 100
type
ligand
sequence M
description BINDING SITE FOR RESIDUE NAG A 1000
source : AC1

3) chain A
residue 13
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

4) chain A
residue 32
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

5) chain A
residue 34
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

6) chain A
residue 75
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

7) chain A
residue 76
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

8) chain A
residue 77
type
ligand
sequence T
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

9) chain A
residue 120
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

10) chain A
residue 215
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

11) chain A
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

12) chain A
residue 289
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

13) chain A
residue 291
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

14) chain A
residue 292
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 0M3 A 1001
source : AC2

15) chain A
residue 12
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

16) chain A
residue 13
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

17) chain A
residue 14
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

18) chain A
residue 30
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

19) chain A
residue 216
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

20) chain A
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

21) chain A
residue 218
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 1002
source : AC3

22) chain A
residue 11
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

23) chain A
residue 272
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

24) chain A
residue 273
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

25) chain A
residue 274
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

26) chain A
residue 275
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

27) chain A
residue 276
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

28) chain A
residue 285
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

29) chain A
residue 307
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 1003
source : AC4

30) chain B
residue 67
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG B 1000
source : AC5

31) chain B
residue 100
type
ligand
sequence M
description BINDING SITE FOR RESIDUE NAG B 1000
source : AC5

32) chain B
residue 13
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

33) chain B
residue 32
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

34) chain B
residue 34
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

35) chain B
residue 75
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

36) chain B
residue 76
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

37) chain B
residue 77
type
ligand
sequence T
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

38) chain B
residue 120
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

39) chain B
residue 215
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

40) chain B
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

41) chain B
residue 291
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

42) chain B
residue 292
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 0M3 B 1001
source : AC6

43) chain B
residue 12
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

44) chain B
residue 13
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

45) chain B
residue 14
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

46) chain B
residue 30
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

47) chain B
residue 216
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

48) chain B
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

49) chain B
residue 218
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 B 1002
source : AC7

50) chain A
residue 38
type ACT_SITE
ligand
sequence V
description
source Swiss-Prot : SWS_FT_FI1

51) chain A
residue 226
type ACT_SITE
ligand
sequence S
description
source Swiss-Prot : SWS_FT_FI1

52) chain B
residue 38
type ACT_SITE
ligand
sequence V
description
source Swiss-Prot : SWS_FT_FI2

53) chain B
residue 226
type ACT_SITE
ligand
sequence S
description
source Swiss-Prot : SWS_FT_FI2

54) chain A
residue 13
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence Q
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

55) chain A
residue 30
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence V
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

56) chain A
residue 32
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence D
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

57) chain A
residue 34-35
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence GS
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

58) chain A
residue 74-77
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence RYST
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

59) chain A
residue 111-112
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence PF
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

60) chain A
residue 114-115
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence LA
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

61) chain A
residue 117
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence F
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

62) chain A
residue 120
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence V
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

63) chain A
residue 213
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence L
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

64) chain A
residue 215
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence D
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

65) chain A
residue 217-219
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence GAS
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

66) chain A
residue 289-292
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence MDIP
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

67) chain A
residue 295
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence T
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_A_1001

68) chain A
residue 66-67
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence HN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_A_1000

69) chain A
residue 69
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_A_1000

70) chain A
residue 100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence M
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_A_1000

71) chain B
residue 13
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence Q
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

72) chain B
residue 30
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence V
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

73) chain B
residue 32
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence D
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

74) chain B
residue 34-35
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence GS
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

75) chain B
residue 74-77
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence RYST
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

76) chain B
residue 111-112
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence PF
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

77) chain B
residue 114-115
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence LA
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

78) chain B
residue 117
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence F
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

79) chain B
residue 120
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence V
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

80) chain B
residue 213
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence L
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

81) chain B
residue 215
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence D
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

82) chain B
residue 217-219
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence GAS
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

83) chain B
residue 289-292
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence MDIP
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

84) chain B
residue 295
type binding
ligand 0M3: (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE
sequence T
description (3S,5R)-N-(2,2-DIPHENYLETHYL)-5-{[(4-METHYLPHENYL)SULFONYL]AMINO}PIPERIDINE-3-CARBOXAMIDE binding site
source pdb_hetatom : 0M3_4gja_B_1001

85) chain B
residue 66-67
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence HN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_B_1000

86) chain B
residue 69
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_B_1000

87) chain B
residue 100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence M
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4gja_B_1000


Display surface

Download
Links