eF-site ID 4gbk-ABCD
PDB Code 4gbk
Chain A, B, C, D

click to enlarge
Title Crystal structure of aspart insulin at pH 8.5
Classification HORMONE
Compound Insulin A chain
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTDK
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTDKT
Description (1)  Insulin A chain, Insulin B chain


Functional site

1) chain A
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

2) chain A
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

3) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

4) chain B
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

5) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

6) chain B
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

7) chain D
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CRS A 101
source : AC1

8) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC2

9) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC2

10) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC2

11) chain A
residue 3
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

12) chain B
residue 26
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

13) chain B
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

14) chain B
residue 28
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

15) chain D
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

16) chain D
residue 21
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

17) chain D
residue 23
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CRS B 103
source : AC4

18) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC5

19) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC5

20) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC5

21) chain A
residue 3
type binding
ligand CRS: M-CRESOL
sequence V
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_B_103

22) chain B
residue 26-29
type binding
ligand CRS: M-CRESOL
sequence YTDK
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_B_103

23) chain D
residue 20-23
type binding
ligand CRS: M-CRESOL
sequence GERG
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_B_103

24) chain A
residue 6-7
type binding
ligand CRS: M-CRESOL
sequence CC
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101

25) chain A
residue 9-11
type binding
ligand CRS: M-CRESOL
sequence SIC
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101

26) chain A
residue 16
type binding
ligand CRS: M-CRESOL
sequence L
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101

27) chain B
residue 7
type binding
ligand CRS: M-CRESOL
sequence C
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101

28) chain B
residue 10-11
type binding
ligand CRS: M-CRESOL
sequence HL
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101

29) chain B
residue 14
type binding
ligand CRS: M-CRESOL
sequence A
description M-CRESOL binding site
source pdb_hetatom : CRS_4gbk_A_101


Display surface

Download
Links