eF-site ID 4g5s-A PDB Code 4g5s Chain A click to enlarge Title Structure of LGN GL3/Galphai3 complex Classification CELL CYCLE/SIGNALING PROTEIN Compound Guanine nucleotide-binding protein G(k) subunit alpha Source Homo sapiens (Human) (GPSM2_MOUSE) Sequence A:  KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKV VVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA GSAEEVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSA SYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFK DLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL VLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKD LFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNR RKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK Description Functional site 1) chain A residue 41 type sequence A description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 2) chain A residue 42 type sequence G description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 3) chain A residue 43 type sequence E description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 4) chain A residue 44 type sequence S description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 5) chain A residue 45 type sequence G description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 6) chain A residue 46 type sequence K description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 7) chain A residue 47 type sequence S description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 8) chain A residue 48 type sequence T description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 9) chain A residue 151 type sequence S description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 10) chain A residue 176 type sequence R description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 11) chain A residue 269 type sequence N description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 12) chain A residue 270 type sequence K description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 13) chain A residue 272 type sequence D description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 14) chain A residue 273 type sequence L description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 15) chain A residue 325 type sequence C description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 16) chain A residue 326 type sequence A description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 17) chain A residue 327 type sequence T description BINDING SITE FOR RESIDUE GDP A 401 source : AC1 18) chain A residue 271 type sequence K description BINDING SITE FOR RESIDUE CIT A 402 source : AC2 19) chain A residue 322 type sequence H description BINDING SITE FOR RESIDUE CIT A 402 source : AC2 20) chain A residue 323 type sequence F description BINDING SITE FOR RESIDUE CIT A 402 source : AC2 21) chain A residue 331 type sequence N description BINDING SITE FOR RESIDUE CIT A 402 source : AC2 22) chain A residue 47 type BINDING sequence S description BINDING => ECO:0000269|PubMed:19478087, ECO:0007744|PDB:2V4Z source Swiss-Prot : SWS_FT_FI2 23) chain A residue 181 type BINDING sequence T description BINDING => ECO:0000269|PubMed:19478087, ECO:0007744|PDB:2V4Z source Swiss-Prot : SWS_FT_FI2 24) chain A residue 150 type BINDING sequence D description BINDING => ECO:0007744|PDB:2V4Z, ECO:0007744|PDB:4G5O, ECO:0007744|PDB:4G5R, ECO:0007744|PDB:4G5S source Swiss-Prot : SWS_FT_FI3 25) chain A residue 200 type BINDING sequence D description BINDING => ECO:0000305|PubMed:19478087, ECO:0007744|PDB:2V4Z source Swiss-Prot : SWS_FT_FI4 26) chain A residue 326 type BINDING sequence A description BINDING => ECO:0007744|PDB:2IHB, ECO:0007744|PDB:2ODE, ECO:0007744|PDB:2V4Z, ECO:0007744|PDB:4G5O, ECO:0007744|PDB:4G5R source Swiss-Prot : SWS_FT_FI5 27) chain A residue 178 type MOD_RES sequence R description ADP-ribosylarginine; by cholera toxin => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 28) chain A residue 204 type MOD_RES sequence Q description Deamidated glutamine; by Photorhabdus PAU_02230 => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links