eF-site ID 4g5r-D
PDB Code 4g5r
Chain D

click to enlarge
Title Structure of LGN GL4/Galphai3 complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(k) subunit alpha
Source Mus musculus (Mouse) (GPSM2_MOUSE)
Sequence D:  KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKV
VVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA
GSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDS
ASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTF
KDLYFKMFDVERKKWIHCFEGVTAIIFCVALSDYDLVLAE
DEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEE
KIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDT
KEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGL
Description (1)  Guanine nucleotide-binding protein G(k) subunit alpha, G-protein-signaling modulator 2


Functional site

1) chain D
residue 275
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT C 402
source : AC8

2) chain D
residue 296
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CIT C 402
source : AC8

3) chain D
residue 297
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT C 402
source : AC8

4) chain D
residue 271
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CIT C 403
source : AC9

5) chain D
residue 323
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CIT C 403
source : AC9

6) chain D
residue 331
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CIT C 403
source : AC9

7) chain D
residue 41
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

8) chain D
residue 42
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

9) chain D
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

10) chain D
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

11) chain D
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

12) chain D
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

13) chain D
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

14) chain D
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

15) chain D
residue 150
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

16) chain D
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

17) chain D
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

18) chain D
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

19) chain D
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

20) chain D
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

21) chain D
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

22) chain D
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

23) chain D
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

24) chain D
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

25) chain D
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP D 401
source : BC2

26) chain D
residue 157
type METAL
ligand
sequence N
description Magnesium (By similarity)
source Swiss-Prot : SWS_FT_FI10

27) chain D
residue 302
type BINDING
ligand
sequence Y
description GTP; via amide nitrogen (By similarity).
source Swiss-Prot : SWS_FT_FI11

28) chain D
residue 151-157
type NP_BIND
ligand
sequence SASYYLN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI12

29) chain D
residue 245-248
type NP_BIND
ligand
sequence ESMK
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI12

30) chain D
residue 275
type binding
ligand CIT: CITRIC ACID
sequence E
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_402

31) chain D
residue 278-279
type binding
ligand CIT: CITRIC ACID
sequence IK
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_402

32) chain D
residue 294-297
type binding
ligand CIT: CITRIC ACID
sequence NTYE
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_402

33) chain D
residue 271
type binding
ligand CIT: CITRIC ACID
sequence K
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_403

34) chain D
residue 322-323
type binding
ligand CIT: CITRIC ACID
sequence HF
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_403

35) chain D
residue 331
type binding
ligand CIT: CITRIC ACID
sequence N
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_403

36) chain D
residue 334-335
type binding
ligand CIT: CITRIC ACID
sequence FV
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_C_403

37) chain D
residue 41-48
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGESGKST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

38) chain D
residue 149-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NDS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

39) chain D
residue 175-176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence LR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

40) chain D
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

41) chain D
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

42) chain D
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401

43) chain D
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_D_401


Display surface

Download
Links