eF-site ID 4g5r-B
PDB Code 4g5r
Chain B

click to enlarge
Title Structure of LGN GL4/Galphai3 complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(k) subunit alpha
Source Mus musculus (Mouse) (GPSM2_MOUSE)
Sequence B:  KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKV
VVYSNTIQSIIAIIRAMGRLKIDFGAARADDARQLFVLAG
SAVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYY
LNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLY
FKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLA
EDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFE
EKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKD
TKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL
Description (1)  Guanine nucleotide-binding protein G(k) subunit alpha, G-protein-signaling modulator 2


Functional site

1) chain B
residue 42
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

2) chain B
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

3) chain B
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

4) chain B
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

5) chain B
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

6) chain B
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

7) chain B
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

8) chain B
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

9) chain B
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

10) chain B
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

11) chain B
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

12) chain B
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

13) chain B
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

14) chain B
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

15) chain B
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

16) chain B
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

17) chain B
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP B 401
source : AC3

18) chain B
residue 275
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

19) chain B
residue 295
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

20) chain B
residue 296
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

21) chain B
residue 297
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

22) chain B
residue 271
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

23) chain B
residue 322
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

24) chain B
residue 323
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

25) chain B
residue 331
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

26) chain B
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 B 404
source : AC6

27) chain B
residue 213
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 B 404
source : AC6

28) chain B
residue 157
type METAL
ligand
sequence N
description Magnesium (By similarity)
source Swiss-Prot : SWS_FT_FI4

29) chain B
residue 302
type BINDING
ligand
sequence Y
description GTP; via amide nitrogen (By similarity).
source Swiss-Prot : SWS_FT_FI5

30) chain B
residue 151-157
type NP_BIND
ligand
sequence SASYYLN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI6

31) chain B
residue 176-180
type NP_BIND
ligand
sequence RTRVK
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI6

32) chain B
residue 245-248
type NP_BIND
ligand
sequence ESMK
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI6

33) chain B
residue 275
type binding
ligand CIT: CITRIC ACID
sequence E
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

34) chain B
residue 279
type binding
ligand CIT: CITRIC ACID
sequence K
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

35) chain B
residue 295-297
type binding
ligand CIT: CITRIC ACID
sequence TYE
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

36) chain B
residue 271
type binding
ligand CIT: CITRIC ACID
sequence K
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

37) chain B
residue 321-324
type binding
ligand CIT: CITRIC ACID
sequence THFT
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

38) chain B
residue 331
type binding
ligand CIT: CITRIC ACID
sequence N
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

39) chain B
residue 334-335
type binding
ligand CIT: CITRIC ACID
sequence FV
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

40) chain B
residue 41-48
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGESGKST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

41) chain B
residue 150-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence DS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

42) chain B
residue 176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

43) chain B
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

44) chain B
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

45) chain B
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401

46) chain B
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_B_401


Display surface

Download
Links