eF-site ID 4g5r-A
PDB Code 4g5r
Chain A

click to enlarge
Title Structure of LGN GL4/Galphai3 complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound Guanine nucleotide-binding protein G(k) subunit alpha
Source Mus musculus (Mouse) (GPSM2_MOUSE)
Sequence A:  KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKV
VVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA
GSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDS
ASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTF
KDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKK
DLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLN
RRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKE
Description (1)  Guanine nucleotide-binding protein G(k) subunit alpha, G-protein-signaling modulator 2


Functional site

1) chain A
residue 41
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

2) chain A
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

3) chain A
residue 44
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

4) chain A
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

5) chain A
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

6) chain A
residue 47
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

7) chain A
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

8) chain A
residue 149
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

9) chain A
residue 151
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

10) chain A
residue 176
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

11) chain A
residue 178
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

12) chain A
residue 269
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

13) chain A
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

14) chain A
residue 272
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

15) chain A
residue 273
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

16) chain A
residue 325
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

17) chain A
residue 326
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

18) chain A
residue 327
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 401
source : AC1

19) chain A
residue 213
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 402
source : AC2

20) chain A
residue 271
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

21) chain A
residue 323
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

22) chain A
residue 331
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

23) chain A
residue 335
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CIT B 402
source : AC4

24) chain A
residue 275
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

25) chain A
residue 295
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

26) chain A
residue 296
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

27) chain A
residue 297
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CIT B 403
source : AC5

28) chain A
residue 157
type METAL
ligand
sequence N
description Magnesium (By similarity)
source Swiss-Prot : SWS_FT_FI1

29) chain A
residue 302
type BINDING
ligand
sequence Y
description GTP; via amide nitrogen (By similarity).
source Swiss-Prot : SWS_FT_FI2

30) chain A
residue 151-157
type NP_BIND
ligand
sequence SASYYLN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI3

31) chain A
residue 176-180
type NP_BIND
ligand
sequence RTRVK
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI3

32) chain A
residue 245-248
type NP_BIND
ligand
sequence ESMK
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI3

33) chain A
residue 40-49
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence GAGESGKSTI
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

34) chain A
residue 149-151
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NDS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

35) chain A
residue 176
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

36) chain A
residue 178
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

37) chain A
residue 200
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

38) chain A
residue 269-273
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence NKKDL
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

39) chain A
residue 324-327
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TCAT
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_4g5r_A_401

40) chain A
residue 271
type binding
ligand CIT: CITRIC ACID
sequence K
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

41) chain A
residue 296
type binding
ligand CIT: CITRIC ACID
sequence Y
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

42) chain A
residue 322-323
type binding
ligand CIT: CITRIC ACID
sequence HF
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

43) chain A
residue 331
type binding
ligand CIT: CITRIC ACID
sequence N
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

44) chain A
residue 334-335
type binding
ligand CIT: CITRIC ACID
sequence FV
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_402

45) chain A
residue 275
type binding
ligand CIT: CITRIC ACID
sequence E
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

46) chain A
residue 278-279
type binding
ligand CIT: CITRIC ACID
sequence IK
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403

47) chain A
residue 294-297
type binding
ligand CIT: CITRIC ACID
sequence NTYE
description CITRIC ACID binding site
source pdb_hetatom : CIT_4g5r_B_403


Display surface

Download
Links