eF-site ID 4fw0-A PDB Code 4fw0 Chain A click to enlarge Title Structure of rat nNOS heme domain in complex with N(delta)-methyl- N(omega)-hydroxy-L-arginine Classification OXIDOREDUCTASE Compound Nitric oxide synthase, brain Source Rattus norvegicus (Rat) (NOS1_RAT) Sequence A:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP TKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIE STSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDA RDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGK HDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQG WKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHP KFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYM GTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQA LVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCR GGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPD PWNTHVW Description Functional site 1) chain A residue 409 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 2) chain A residue 414 type sequence R description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 3) chain A residue 415 type sequence C description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 4) chain A residue 416 type sequence V description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 5) chain A residue 457 type sequence S description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 6) chain A residue 584 type sequence F description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 7) chain A residue 585 type sequence S description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 8) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 9) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 10) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 11) chain A residue 704 type sequence F description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 12) chain A residue 706 type sequence Y description BINDING SITE FOR RESIDUE HEM A 801 source : AC1 13) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE H4B A 802 source : AC2 14) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE H4B A 802 source : AC2 15) chain A residue 677 type sequence V description BINDING SITE FOR RESIDUE H4B A 802 source : AC2 16) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE H4B A 802 source : AC2 17) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE ACT A 803 source : AC3 18) chain A residue 478 type sequence Q description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 19) chain A residue 562 type sequence Y description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 20) chain A residue 565 type sequence P description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 21) chain A residue 586 type sequence G description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 22) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 23) chain A residue 588 type sequence Y description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 24) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 25) chain A residue 597 type sequence D description BINDING SITE FOR RESIDUE 5KJ A 804 source : AC4 26) chain A residue 326 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 27) chain A residue 331 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 28) chain A residue 676 type sequence W description BINDING SITE FOR RESIDUE H4B B 802 source : AC7 29) chain A residue 691 type sequence F description BINDING SITE FOR RESIDUE H4B B 802 source : AC7 30) chain A residue 692 type sequence H description BINDING SITE FOR RESIDUE H4B B 802 source : AC7 31) chain A residue 693 type sequence Q description BINDING SITE FOR RESIDUE H4B B 802 source : AC7 32) chain A residue 694 type sequence E description BINDING SITE FOR RESIDUE H4B B 802 source : AC7 33) chain A residue 587 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 588 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 592 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 677 type BINDING sequence V description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 678 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 691 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 706 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 41) chain A residue 334 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 42) chain A residue 414-421 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 43) chain A residue 415 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links