eF-site ID 4fhi-A PDB Code 4fhi Chain A click to enlarge Title Development of synthetically accessible non-secosteroidal hybrid molecules combining vitamin D receptor agonism and histone deacetylase inhibition Classification Transcription/protein binding/inhibitor Compound Vitamin Nuclear Receptor Source (4FHI) Sequence A:  MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSM LPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSS AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHT LELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGV QDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLA DLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV Description Functional site 1) chain A residue 175 type sequence Y description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 2) chain A residue 259 type sequence A description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 3) chain A residue 262 type sequence V description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 4) chain A residue 264 type sequence Y description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 5) chain A residue 265 type sequence S description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 6) chain A residue 302 type sequence R description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 7) chain A residue 303 type sequence S description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 8) chain A residue 306 type sequence S description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 9) chain A residue 314 type sequence W description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 10) chain A residue 316 type sequence C description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 11) chain A residue 323 type sequence Y description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 12) chain A residue 328 type sequence V description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 13) chain A residue 333 type sequence H description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 14) chain A residue 423 type sequence H description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 15) chain A residue 427 type sequence Y description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 16) chain A residue 430 type sequence L description BINDING SITE FOR RESIDUE 0S4 A 501 source : AC1 17) chain A residue 175 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:17218092, ECO:0000269|PubMed:17346665 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 255 type BINDING sequence L description BINDING => ECO:0000269|PubMed:17218092, ECO:0000269|PubMed:17346665 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 299 type BINDING sequence I description BINDING => ECO:0000269|PubMed:17218092, ECO:0000269|PubMed:17346665 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 333 type BINDING sequence H description BINDING => ECO:0000269|PubMed:17218092, ECO:0000269|PubMed:17346665 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 423 type BINDING sequence H description BINDING => ECO:0000269|PubMed:17218092, ECO:0000269|PubMed:17346665 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links