eF-site ID 4fg3-D PDB Code 4fg3 Chain D click to enlarge Title Crystal Structure Analysis of the Human Insulin Classification HORMONE Compound Insulin Source Homo sapiens (Human) (INS_HUMAN) Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description (1)  Insulin Functional site 1) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 101 source : AC3 2) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 101 source : AC3 3) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 101 source : AC3 4) chain D residue 2 type sequence V description BINDING SITE FOR RESIDUE GOL D 103 source : AC5 5) chain D residue 3 type sequence N description BINDING SITE FOR RESIDUE GOL D 103 source : AC5 6) chain D residue 4 type sequence Q description BINDING SITE FOR RESIDUE GOL D 103 source : AC5 7) chain D residue 5 type sequence H description BINDING SITE FOR RESIDUE GOL D 103 source : AC5 8) chain D residue 6 type sequence L description BINDING SITE FOR RESIDUE GOL D 103 source : AC5

Display surface Download Links