eF-site ID 4fe1-M PDB Code 4fe1 Chain M click to enlarge Title Improving the Accuracy of Macromolecular Structure Refinement at 7 A Resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence M:  MALTDTQVYVALVIALLPAVLAFRLSTELYK Description Functional site 1) chain M residue 11 type sequence A description BINDING SITE FOR RESIDUE CLA B 806 source : GC8 2) chain M residue 26 type sequence S description BINDING SITE FOR RESIDUE CLA M 1201 source : NC7 3) chain M residue 27 type sequence T description BINDING SITE FOR RESIDUE CLA M 1201 source : NC7 4) chain M residue 29 type sequence L description BINDING SITE FOR RESIDUE CLA M 1201 source : NC7 5) chain M residue 30 type sequence Y description BINDING SITE FOR RESIDUE CLA M 1201 source : NC7 6) chain M residue 31 type sequence K description BINDING SITE FOR RESIDUE CLA M 1201 source : NC7 7) chain M residue 9 type sequence Y description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 8) chain M residue 13 type sequence V description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 9) chain M residue 15 type sequence A description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 10) chain M residue 16 type sequence L description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 11) chain M residue 18 type sequence P description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 12) chain M residue 19 type sequence A description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 13) chain M residue 22 type sequence A description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 14) chain M residue 26 type sequence S description BINDING SITE FOR RESIDUE BCR M 1203 source : NC9 15) chain M residue 7-26 type TRANSMEM sequence QVYVALVIALLPAVLAFRLS description Helical => ECO:0000255|HAMAP-Rule:MF_00828 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links