eF-site ID 4fe1-J PDB Code 4fe1 Chain J click to enlarge Title Improving the Accuracy of Macromolecular Structure Refinement at 7 A Resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence J:  MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHP L Description Functional site 1) chain J residue 7 type sequence Y description BINDING SITE FOR RESIDUE CLA A 804 source : AC4 2) chain J residue 27 type sequence I description BINDING SITE FOR RESIDUE CLA A 809 source : AC9 3) chain J residue 7 type sequence Y description BINDING SITE FOR RESIDUE CLA A 811 source : BC2 4) chain J residue 11 type sequence A description BINDING SITE FOR RESIDUE CLA A 841 source : EC5 5) chain J residue 19 type sequence M description BINDING SITE FOR RESIDUE CLA A 842 source : EC6 6) chain J residue 29 type sequence F description BINDING SITE FOR RESIDUE CLA B 831 source : JC6 7) chain J residue 30 type sequence N description BINDING SITE FOR RESIDUE CLA B 831 source : JC6 8) chain J residue 35 type sequence D description BINDING SITE FOR RESIDUE CLA B 831 source : JC6 9) chain J residue 36 type sequence L description BINDING SITE FOR RESIDUE CLA B 831 source : JC6 10) chain J residue 33 type sequence Y description BINDING SITE FOR RESIDUE BCR B 850 source : LC7 11) chain J residue 36 type sequence L description BINDING SITE FOR RESIDUE BCR B 850 source : LC7 12) chain J residue 37 type sequence L description BINDING SITE FOR RESIDUE BCR B 850 source : LC7 13) chain J residue 40 type sequence P description BINDING SITE FOR RESIDUE BCR B 850 source : LC7 14) chain J residue 18 type sequence W description BINDING SITE FOR RESIDUE CLA F 1301 source : MC1 15) chain J residue 22 type sequence T description BINDING SITE FOR RESIDUE CLA F 1301 source : MC1 16) chain J residue 26 type sequence L description BINDING SITE FOR RESIDUE CLA F 1301 source : MC1 17) chain J residue 11 type sequence A description BINDING SITE FOR RESIDUE CLA J 1101 source : MC5 18) chain J residue 12 type sequence P description BINDING SITE FOR RESIDUE CLA J 1101 source : MC5 19) chain J residue 16 type sequence A description BINDING SITE FOR RESIDUE CLA J 1101 source : MC5 20) chain J residue 21 type sequence I description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 21) chain J residue 24 type sequence G description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 22) chain J residue 25 type sequence I description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 23) chain J residue 28 type sequence E description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 24) chain J residue 31 type sequence R description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 25) chain J residue 32 type sequence F description BINDING SITE FOR RESIDUE CLA J 1102 source : MC6 26) chain J residue 39 type sequence H description BINDING SITE FOR RESIDUE CLA J 1103 source : MC7 27) chain J residue 41 type sequence L description BINDING SITE FOR RESIDUE CLA J 1103 source : MC7 28) chain J residue 23 type sequence A description BINDING SITE FOR RESIDUE BCR J 1104 source : MC8 29) chain J residue 26 type sequence L description BINDING SITE FOR RESIDUE BCR J 1104 source : MC8 30) chain J residue 30 type sequence N description BINDING SITE FOR RESIDUE BCR J 1104 source : MC8 31) chain J residue 7 type sequence Y description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9 32) chain J residue 12 type sequence P description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9 33) chain J residue 16 type sequence A description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9 34) chain J residue 20 type sequence T description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9 35) chain J residue 28 type sequence E description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9 36) chain J residue 31 type sequence R description BINDING SITE FOR RESIDUE BCR J 1105 source : MC9

Display surface Download Links