eF-site ID 4fe1-K PDB Code 4fe1 Chain K click to enlarge Title Improving the Accuracy of Macromolecular Structure Refinement at 7 A Resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence K:  ILCNLFAIALGRYIQSRGKGPGLGLPELLATTSFGHLLAA GVVSGL Description Functional site 1) chain K residue 75 type sequence S description BINDING SITE FOR RESIDUE CLA A 817 source : BC8 2) chain K residue 57 type sequence P description BINDING SITE FOR RESIDUE CLA A 820 source : CC2 3) chain K residue 58 type sequence E description BINDING SITE FOR RESIDUE CLA A 820 source : CC2 4) chain K residue 61 type sequence A description BINDING SITE FOR RESIDUE CLA A 820 source : CC2 5) chain K residue 35 type sequence Q description BINDING SITE FOR RESIDUE CLA A 822 source : CC4 6) chain K residue 36 type sequence S description BINDING SITE FOR RESIDUE CLA A 822 source : CC4 7) chain K residue 37 type sequence R description BINDING SITE FOR RESIDUE CLA A 822 source : CC4 8) chain K residue 21 type sequence L description BINDING SITE FOR RESIDUE CLA A 844 source : EC8 9) chain K residue 22 type sequence C description BINDING SITE FOR RESIDUE CLA A 844 source : EC8 10) chain K residue 35 type sequence Q description BINDING SITE FOR RESIDUE BCR A 847 source : FC2 11) chain K residue 64 type sequence S description BINDING SITE FOR RESIDUE BCR A 847 source : FC2 12) chain K residue 65 type sequence F description BINDING SITE FOR RESIDUE BCR A 847 source : FC2 13) chain K residue 75 type sequence S description BINDING SITE FOR RESIDUE CLA A 855 source : GC1

Display surface Download Links