eF-site ID 4f7h-A PDB Code 4f7h Chain A click to enlarge Title The crystal structure of kindlin-2 pleckstrin homology domain in free form Classification CELL ADHESION Compound Fermitin family homolog 2 Source Homo sapiens (Human) (FERM2_HUMAN) Sequence A:  ILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSI SCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLL IPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS YNLEVQNILSFLKMQ Description Functional site 1) chain A residue 401 type sequence D description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 2) chain A residue 402 type sequence T description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 3) chain A residue 403 type sequence S description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 4) chain A residue 410 type sequence K description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 5) chain A residue 411 type sequence E description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 6) chain A residue 412 type sequence E description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 7) chain A residue 413 type sequence S description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 8) chain A residue 414 type sequence S description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 9) chain A residue 422 type sequence N description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 10) chain A residue 424 type sequence R description BINDING SITE FOR RESIDUE SRT A 601 source : AC1 11) chain A residue 400 type sequence K description BINDING SITE FOR RESIDUE SRT A 602 source : AC2 12) chain A residue 476 type sequence K description BINDING SITE FOR RESIDUE SRT A 602 source : AC2 13) chain A residue 477 type sequence G description BINDING SITE FOR RESIDUE SRT A 602 source : AC2 14) chain A residue 478 type sequence K description BINDING SITE FOR RESIDUE SRT A 602 source : AC2 15) chain A residue 383 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links