eF-site ID 4f4o-J PDB Code 4f4o Chain J click to enlarge Title Structure of the Haptoglobin-Haemoglobin Complex Classification OXYGEN TRANSPORT/TRANSPORT PROTEIN Compound Hemoglobin subunit alpha Source ORGANISM_COMMON: pigs,swine,wild boar; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence J:  VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTK TYFPHFNLSHGSDQVKAHGQKVADALTKAVGHLDDLPGAL SALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS VHASLDKFLANVSTVLTSKYR Description Functional site 1) chain J residue 108 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P01942 source Swiss-Prot : SWS_FT_FI7 2) chain J residue 134 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P01942 source Swiss-Prot : SWS_FT_FI7 3) chain J residue 137 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P01942 source Swiss-Prot : SWS_FT_FI7 4) chain J residue 3 type MOD_RES sequence S description N-acetylvaline => ECO:0000250|UniProtKB:P02086 source Swiss-Prot : SWS_FT_FI3 5) chain J residue 49 type MOD_RES sequence S description N-acetylvaline => ECO:0000250|UniProtKB:P02086 source Swiss-Prot : SWS_FT_FI3 6) chain J residue 7 type MOD_RES sequence K description Phosphoserine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI4 7) chain J residue 11 type MOD_RES sequence K description Phosphoserine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI4 8) chain J residue 40 type MOD_RES sequence K description Phosphoserine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI4 9) chain J residue 102 type MOD_RES sequence S description S-nitrosocysteine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI6 10) chain J residue 124 type MOD_RES sequence S description S-nitrosocysteine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI6 11) chain J residue 138 type MOD_RES sequence S description S-nitrosocysteine => ECO:0000250|UniProtKB:P68871 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links