eF-site ID 4ewx-D
PDB Code 4ewx
Chain D

click to enlarge
Title Human Insulin
Classification HORMONE
Compound Insulin A chain
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin A chain, Insulin B chain


Functional site

1) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3

2) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3

3) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3


Display surface

Download
Links