eF-site ID 4ewx-ABCD
PDB Code 4ewx
Chain A, B, C, D

click to enlarge
Title Human Insulin
Classification HORMONE
Compound Insulin A chain
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin A chain, Insulin B chain


Functional site

1) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC1

2) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC1

3) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 101
source : AC1

4) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3

5) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3

6) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 101
source : AC3


Display surface

Download
Links