eF-site ID 4ehp-AB PDB Code 4ehp Chain A, B click to enlarge Title Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382) Classification CELL ADHESION Compound Vinculin Source Homo sapiens (Human) (CTNA1_HUMAN) Sequence A:  PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLT APVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKV ENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSD LLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYT KNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKEL LPVLISAMKIFVTTKNSKIEEALKNRNFTVEKMSAEINEI IRVLQLTS B:  IVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDR RERIVAECNAVRQALQDLLSEYMGNAGRKERSDALNSAID KMTKKTRDLRRQL Description Functional site 1) chain A residue 6 type sequence T description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 2) chain A residue 9 type sequence I description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 3) chain A residue 127 type sequence D description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 4) chain B residue 330 type sequence R description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 5) chain A residue 39 type sequence D description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 6) chain A residue 250 type sequence L description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 7) chain A residue 251 type sequence T description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 8) chain A residue 252 type sequence S description BINDING SITE FOR RESIDUE ACT A 302 source : AC2 9) chain A residue 245 type sequence I description BINDING SITE FOR RESIDUE ACT A 303 source : AC3 10) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE ACT A 303 source : AC3 11) chain A residue 207 type sequence S description BINDING SITE FOR RESIDUE ACT A 304 source : AC4 12) chain A residue 228 type sequence K description BINDING SITE FOR RESIDUE ACT A 304 source : AC4 13) chain A residue 229 type sequence N description BINDING SITE FOR RESIDUE ACT A 304 source : AC4 14) chain A residue 32 type sequence V description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 15) chain A residue 35 type sequence K description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 16) chain A residue 100 type sequence Y description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 17) chain A residue 101 type sequence S description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 18) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 19) chain B residue 351 type sequence Y description BINDING SITE FOR RESIDUE ACT A 305 source : AC5 20) chain A residue 197 type sequence T description BINDING SITE FOR RESIDUE ACT A 306 source : AC6 21) chain A residue 200 type sequence E description BINDING SITE FOR RESIDUE ACT A 306 source : AC6 22) chain A residue 65 type sequence T description BINDING SITE FOR RESIDUE ACT A 307 source : AC7 23) chain A residue 126 type sequence F description BINDING SITE FOR RESIDUE ACT A 307 source : AC7 24) chain A residue 133 type sequence K description BINDING SITE FOR RESIDUE ACT A 307 source : AC7 25) chain B residue 329 type sequence R description BINDING SITE FOR RESIDUE ACT A 307 source : AC7 26) chain A residue 87 type sequence K description BINDING SITE FOR RESIDUE ACT A 308 source : AC8 27) chain A residue 110 type sequence D description BINDING SITE FOR RESIDUE ACT A 308 source : AC8 28) chain A residue 2 type sequence P description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 29) chain A residue 90 type sequence Q description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 30) chain A residue 107 type sequence Y description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 31) chain A residue 183 type sequence T description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 32) chain A residue 185 type sequence Q description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 33) chain A residue 186 type sequence E description BINDING SITE FOR RESIDUE ACT A 309 source : AC9 34) chain A residue 162-182 type prosite sequence KNLGPGMTKMAKMIDERQQEL description VINCULIN_1 Vinculin family talin-binding region signature. KnLgpgMtkMakmideRQQEL source prosite : PS00663 35) chain B residue 295 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 36) chain B residue 297 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 173 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links