eF-site ID 4ehp-A
PDB Code 4ehp
Chain A

click to enlarge
Title Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)
Classification CELL ADHESION
Compound Vinculin
Source Homo sapiens (Human) (CTNA1_HUMAN)
Sequence A:  PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLT
APVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKV
ENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSD
LLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYT
KNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKEL
LPVLISAMKIFVTTKNSKIEEALKNRNFTVEKMSAEINEI
IRVLQLTS
Description (1)  Vinculin, Catenin alpha-1


Functional site

1) chain A
residue 6
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ACT A 301
source : AC1

2) chain A
residue 9
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ACT A 301
source : AC1

3) chain A
residue 127
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ACT A 301
source : AC1

4) chain A
residue 39
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ACT A 302
source : AC2

5) chain A
residue 250
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ACT A 302
source : AC2

6) chain A
residue 251
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ACT A 302
source : AC2

7) chain A
residue 252
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT A 302
source : AC2

8) chain A
residue 245
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ACT A 303
source : AC3

9) chain A
residue 249
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ACT A 303
source : AC3

10) chain A
residue 207
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT A 304
source : AC4

11) chain A
residue 228
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ACT A 304
source : AC4

12) chain A
residue 229
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ACT A 304
source : AC4

13) chain A
residue 32
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ACT A 305
source : AC5

14) chain A
residue 35
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ACT A 305
source : AC5

15) chain A
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ACT A 305
source : AC5

16) chain A
residue 101
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT A 305
source : AC5

17) chain A
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ACT A 305
source : AC5

18) chain A
residue 197
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ACT A 306
source : AC6

19) chain A
residue 200
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT A 306
source : AC6

20) chain A
residue 65
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ACT A 307
source : AC7

21) chain A
residue 126
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ACT A 307
source : AC7

22) chain A
residue 133
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ACT A 307
source : AC7

23) chain A
residue 87
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ACT A 308
source : AC8

24) chain A
residue 110
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ACT A 308
source : AC8

25) chain A
residue 2
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

26) chain A
residue 90
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

27) chain A
residue 107
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

28) chain A
residue 183
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

29) chain A
residue 185
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

30) chain A
residue 186
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT A 309
source : AC9

31) chain A
residue 2
type binding
ligand ACT: ACETATE ION
sequence P
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_309

32) chain A
residue 183-186
type binding
ligand ACT: ACETATE ION
sequence THQE
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_309

33) chain A
residue 6
type binding
ligand ACT: ACETATE ION
sequence T
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

34) chain A
residue 8-9
type binding
ligand ACT: ACETATE ION
sequence TI
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

35) chain A
residue 123
type binding
ligand ACT: ACETATE ION
sequence L
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

36) chain A
residue 126-127
type binding
ligand ACT: ACETATE ION
sequence FD
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

37) chain A
residue 178
type binding
ligand ACT: ACETATE ION
sequence R
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

38) chain A
residue 181
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_301

39) chain A
residue 32-35
type binding
ligand ACT: ACETATE ION
sequence VDGK
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_305

40) chain A
residue 37
type binding
ligand ACT: ACETATE ION
sequence I
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_305

41) chain A
residue 95
type binding
ligand ACT: ACETATE ION
sequence L
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_305

42) chain A
residue 99-102
type binding
ligand ACT: ACETATE ION
sequence PYSV
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_305

43) chain A
residue 105
type binding
ligand ACT: ACETATE ION
sequence R
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_305

44) chain A
residue 61
type binding
ligand ACT: ACETATE ION
sequence T
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

45) chain A
residue 65-67
type binding
ligand ACT: ACETATE ION
sequence TED
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

46) chain A
residue 70
type binding
ligand ACT: ACETATE ION
sequence L
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

47) chain A
residue 126
type binding
ligand ACT: ACETATE ION
sequence F
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

48) chain A
residue 129-130
type binding
ligand ACT: ACETATE ION
sequence AE
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

49) chain A
residue 133
type binding
ligand ACT: ACETATE ION
sequence K
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_307

50) chain A
residue 80
type binding
ligand ACT: ACETATE ION
sequence K
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_308

51) chain A
residue 83-84
type binding
ligand ACT: ACETATE ION
sequence NA
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_308

52) chain A
residue 87
type binding
ligand ACT: ACETATE ION
sequence K
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_308

53) chain A
residue 110
type binding
ligand ACT: ACETATE ION
sequence D
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_308

54) chain A
residue 114
type binding
ligand ACT: ACETATE ION
sequence G
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_308

55) chain A
residue 135
type binding
ligand ACT: ACETATE ION
sequence I
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_303

56) chain A
residue 139
type binding
ligand ACT: ACETATE ION
sequence K
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_303

57) chain A
residue 245
type binding
ligand ACT: ACETATE ION
sequence I
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_303

58) chain A
residue 249
type binding
ligand ACT: ACETATE ION
sequence Q
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_303

59) chain A
residue 228-229
type binding
ligand ACT: ACETATE ION
sequence KN
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_304

60) chain A
residue 232
type binding
ligand ACT: ACETATE ION
sequence F
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_304

61) chain A
residue 249-252
type binding
ligand ACT: ACETATE ION
sequence QLTS
description ACETATE ION binding site
source pdb_hetatom : ACT_4ehp_A_302


Display surface

Download
Links