eF-site ID 4e6k-E PDB Code 4e6k Chain E click to enlarge Title 2.0 A resolution structure of Pseudomonas aeruginosa bacterioferritin (BfrB) in complex with bacterioferritin associated ferredoxin (Bfd) Classification METAL BINDING PROTEIN/ELECTRON TRANSPORT Compound Bacterioferritin Source Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (Q9HY80_PSEAE) Sequence E:  MKGDKKVIQHLNKILGNELIAINQYFLHSRMWNDWGLKRL GAHEYHESIDEMKHADKLIERILFLEGLPNLQDLGKLLIG ENTQEMLQCDLNLELKATKDLREAIVHCEQVHDYVSRDLL KDILESEEEHIDYLETQLGLIQKVGLENYLQSHMHE Description Functional site 1) chain E residue 148 type sequence N description BINDING SITE FOR RESIDUE K B 201 source : AC4 2) chain E residue 151 type sequence Q description BINDING SITE FOR RESIDUE K B 201 source : AC4 3) chain E residue 34 type sequence D description BINDING SITE FOR RESIDUE NA C 202 source : AC7 4) chain E residue 19 type sequence L description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 5) chain E residue 23 type sequence N description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 6) chain E residue 26 type sequence F description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 7) chain E residue 45 type sequence Y description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 8) chain E residue 49 type sequence I description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 9) chain E residue 52 type sequence M description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 10) chain E residue 53 type sequence K description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 11) chain E residue 71 type sequence L description BINDING SITE FOR RESIDUE HEM E 201 source : AC9 12) chain E residue 132 type sequence D description BINDING SITE FOR RESIDUE NA E 202 source : BC1 13) chain E residue 136 type sequence T description BINDING SITE FOR RESIDUE NA E 202 source : BC1

Display surface Download Links