eF-site ID 4dvl-B PDB Code 4dvl Chain B click to enlarge Title Crystal structure of the glycoprotein Erns from the pestivirus BVDV-1 in complex with 2'-3'-cyclo-UMP Classification VIRAL PROTEIN Compound E(rns) glycoprotein Source (POLG_BVDVC) Sequence B:  ENITQWNLQDNGTEGIQRAMFQRGVNRSLHGIWPEKICTG VPSHLATDTELKAIHGMMDASEKTNYTCCRLQRHEWNKHG WCNWYNIEPWILLMNKTQANLTEGQPLRECAVTCRYDRDS DLNVVTQARDSPTPLTGCKKGKNFSFAGILVQGPCNFEIA V Description Functional site 1) chain B residue 76 type ACT_SITE sequence H description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 2) chain B residue 77 type ACT_SITE sequence E description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 3) chain B residue 80 type ACT_SITE sequence K description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 4) chain B residue 81 type ACT_SITE sequence H description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 5) chain B residue 32 type SITE sequence H description Hydrogen donor to release the cleavage products of E(rns) glycoprotein RNase activity source Swiss-Prot : SWS_FT_FI2 6) chain B residue 67 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 7) chain B residue 97 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 8) chain B residue 102 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 9) chain B residue 4 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 10) chain B residue 13 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 11) chain B residue 28 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 145 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links