eF-site ID 4dvl-A PDB Code 4dvl Chain A click to enlarge Title Crystal structure of the glycoprotein Erns from the pestivirus BVDV-1 in complex with 2'-3'-cyclo-UMP Classification VIRAL PROTEIN Compound E(rns) glycoprotein Source (POLG_BVDVC) Sequence A:  ENITQWNLQDNGTEGIQRAMFQRGVNRSLHGIWPEKICTG VPSHLATDTELKAIHGMMDASEKTNYTCCRLQRHEWNKHG WCNWYNIEPWILLMNKTQANLTEGQPLRECAVTCRYDRDS DLNVVTQARDSPTPLTGCKKGKNFSFAGILVQGPCNFEIA V Description Functional site 1) chain A residue 73-84 type prosite sequence LQRHEWNKHGWC description RNASE_T2_2 Ribonuclease T2 family histidine active site 2. LqrHEWnKHGwC source prosite : PS00531 2) chain A residue 32 type SITE sequence H description Hydrogen donor to release the cleavage products of E(rns) glycoprotein RNase activity source Swiss-Prot : SWS_FT_FI2 3) chain A residue 4 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 13 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 5) chain A residue 28 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 67 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 97 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 102 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 145 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 76 type ACT_SITE sequence H description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 77 type ACT_SITE sequence E description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 80 type ACT_SITE sequence K description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 81 type ACT_SITE sequence H description For E(rns) glycoprotein RNase activity => ECO:0000269|PubMed:22579253 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links