eF-site ID 4dbz-A PDB Code 4dbz Chain A click to enlarge Title Crystal Structure of V151L Actinorhodin Polyketide Ketoreductase with NADPH Classification OXIDOREDUCTASE Compound Ketoacyl reductase Source Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (ACT3_STRCO) Sequence A:  DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLR TTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPV DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQ VLKAGGMLERGTGRIVNIASTGGKQGLVHAAPYSASKHGV VGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSD IWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGA AAVTAQALNVCGGLGNY Description Functional site 1) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 2) chain A residue 15 type sequence T description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 3) chain A residue 16 type sequence S description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 4) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 5) chain A residue 18 type sequence I description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 6) chain A residue 37 type sequence A description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 7) chain A residue 38 type sequence R description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 8) chain A residue 39 type sequence G description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 9) chain A residue 62 type sequence C description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 10) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 11) chain A residue 64 type sequence V description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 12) chain A residue 90 type sequence N description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 13) chain A residue 91 type sequence A description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 14) chain A residue 92 type sequence G description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 15) chain A residue 142 type sequence I description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 16) chain A residue 143 type sequence A description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 17) chain A residue 144 type sequence S description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 18) chain A residue 157 type sequence Y description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 19) chain A residue 161 type sequence K description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 20) chain A residue 187 type sequence P description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 21) chain A residue 190 type sequence V description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 22) chain A residue 192 type sequence T description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 23) chain A residue 193 type sequence P description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 24) chain A residue 194 type sequence M description BINDING SITE FOR RESIDUE NDP A 301 source : AC1 25) chain A residue 144-172 type prosite sequence STGGKQGLVHAAPYSASKHGVVGFTKALG description ADH_SHORT Short-chain dehydrogenases/reductases family signature. StggkqglvhAapYSASKHGVvGFTkALG source prosite : PS00061 26) chain A residue 157 type ACT_SITE sequence Y description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10001 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 11 type BINDING sequence V description BINDING => ECO:0000269|PubMed:15458634, ECO:0000269|PubMed:15544323 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 63 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15458634, ECO:0000269|PubMed:15544323 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 161 type BINDING sequence K description BINDING => ECO:0000269|PubMed:15458634, ECO:0000269|PubMed:15544323 source Swiss-Prot : SWS_FT_FI2 30) chain A residue 144 type BINDING sequence S description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links