eF-site ID 4daw-A PDB Code 4daw Chain A click to enlarge Title Crystal structure of PAK1 kinase domain with the ruthenium phthalimide complex Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Serine/threonine-protein kinase PAK 1 Source Homo sapiens (Human) (PAK1_HUMAN) Sequence A:  SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAM DVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIV NYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAA VCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDF GFCAQITPEQSKRSXMVGTPYWMAPEVVTRKAYGPKVDIW SLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE KLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLS SLTPLIAAAKEATK Description Functional site 1) chain A residue 276 type sequence I description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 2) chain A residue 281 type sequence S description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 3) chain A residue 282 type sequence G description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 4) chain A residue 284 type sequence V description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 5) chain A residue 297 type sequence A description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 6) chain A residue 299 type sequence R description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 7) chain A residue 328 type sequence V description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 8) chain A residue 344 type sequence M description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 9) chain A residue 345 type sequence E description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 10) chain A residue 346 type sequence Y description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 11) chain A residue 347 type sequence L description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 12) chain A residue 396 type sequence L description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 13) chain A residue 406 type sequence T description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 14) chain A residue 407 type sequence D description BINDING SITE FOR RESIDUE 0H2 A 601 source : AC1 15) chain A residue 389 type ACT_SITE sequence D description Proton acceptor => ECO:0000269|PubMed:22153498 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 285 type MOD_RES sequence Y description Phosphotyrosine; by JAK2 => ECO:0000269|PubMed:17726028, ECO:0000269|PubMed:17989089 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 276 type BINDING sequence I description BINDING => ECO:0000269|PubMed:22153498 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 299 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22153498 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 345 type BINDING sequence E description BINDING => ECO:0000269|PubMed:22153498 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 385-397 type prosite sequence VIHRDIKSDNILL description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ViHrDIKsdNILL source prosite : PS00108 21) chain A residue 423 type MOD_RES sequence X description Phosphothreonine; by autocatalysis, BRSK2 and PDPK1 => ECO:0000269|PubMed:10551809, ECO:0000269|PubMed:10995762, ECO:0000269|PubMed:22153498, ECO:0000269|PubMed:22669945 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links