eF-site ID 4d60-B PDB Code 4d60 Chain B click to enlarge Title Structure of a dimeric Plasmodium falciparum profilin mutant Classification STRUCTURAL PROTEIN Compound PROFILIN Source Plasmodium falciparum (isolate HB3) (PROF_PLAFX) Sequence B:  EYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEE SDPNFDKWSLFYKEDYDIEVKTTKTINEGQTILVVFNEGY APDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGL HLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAES S Description Functional site 1) chain B residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1165 source : AC3 2) chain B residue 99 type sequence N description BINDING SITE FOR RESIDUE SO4 B 1166 source : AC4 3) chain B residue 101 type sequence E description BINDING SITE FOR RESIDUE SO4 B 1166 source : AC4 4) chain B residue 146 type sequence R description BINDING SITE FOR RESIDUE SO4 B 1166 source : AC4 5) chain B residue 150 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1166 source : AC4 6) chain B residue 35 type SITE sequence Y description Interaction with Pro-rich sequence => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 7) chain B residue 89 type SITE sequence W description Interaction with actin => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links