eF-site ID 4d60-A PDB Code 4d60 Chain A click to enlarge Title Structure of a dimeric Plasmodium falciparum profilin mutant Classification STRUCTURAL PROTEIN Compound PROFILIN Source Plasmodium falciparum (isolate HB3) (PROF_PLAFX) Sequence A:  EYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEE SDPNFDKWSLFYKEDYDIEVKTTKTINEGQTILVVFNEGY APDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGL HLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAES S Description Functional site 1) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE SO4 A 1165 source : AC1 2) chain A residue 82 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1165 source : AC1 3) chain A residue 102 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1165 source : AC1 4) chain A residue 99 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1166 source : AC2 5) chain A residue 101 type sequence E description BINDING SITE FOR RESIDUE SO4 A 1166 source : AC2 6) chain A residue 150 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1166 source : AC2 7) chain A residue 35 type SITE sequence Y description Interaction with Pro-rich sequence => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 89 type SITE sequence W description Interaction with actin => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links