eF-site ID 4d3c-H
PDB Code 4d3c
Chain H

click to enlarge
Title Crystal structure of the NK1 domain of HGF in complex with anti-HGF monoclonal antibody SFN68.
Classification PROTEIN BINDING
Compound HEPATOCYTE GROWTH FACTOR
Source ORGANISM_COMMON: RABBIT; ORGANISM_SCIENTIFIC: ORYCTOLAGUS CUNICULUS;
Sequence H:  QQQLVESGGRLVNPGESLTLTCKASGFTFSTYYMSWVRQA
PGKGLEWIGYIGTSSGTTYYANSVKGRFTISSDNAQNTVF
LQMTSLTDSDTATYFCARGLGRINLWGPGTLVTVSSASTK
GPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGV
HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPS
NTKVDKRVES
Description (1)  HEPATOCYTE GROWTH FACTOR, SFN68 FAB

Display surface

Download
Links