eF-site ID 4cmo-A PDB Code 4cmo Chain A click to enlarge Title Structure of the Human Anaplastic Lymphoma Kinase in Complex with the inhibitor 2-((1R)-1-((3-amino-6-(2-methoxypyridin-3-yl)pyrazin-2-yl) oxy)ethyl)-4-fluoro-N-methylbenzamide Classification TRANSFERASE Compound ALK TYROSINE KINASE RECEPTOR Source (ALK_HUMAN) Sequence A:  NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYE GQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIV RCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSS LAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP GPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIF TSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGG RMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYC TQDPDVINTALPIEYG Description Functional site 1) chain A residue 1130 type sequence V description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 2) chain A residue 1148 type sequence A description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 3) chain A residue 1196 type sequence L description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 4) chain A residue 1197 type sequence E description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 5) chain A residue 1199 type sequence M description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 6) chain A residue 1202 type sequence G description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 7) chain A residue 1253 type sequence R description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 8) chain A residue 1254 type sequence N description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 9) chain A residue 1256 type sequence L description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 10) chain A residue 1269 type sequence G description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 11) chain A residue 1270 type sequence D description BINDING SITE FOR RESIDUE YPW A 2402 source : AC1 12) chain A residue 1122-1150 type prosite sequence LGHGAFGEVYEGQVPLQVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGHGAFGEVYeGqvsgmpndpsplq.....VAVK source prosite : PS00107 13) chain A residue 1245-1257 type prosite sequence FIHRDIAARNCLL description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FIHrDIAARNCLL source prosite : PS00109 14) chain A residue 1249 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 1150 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 1096 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16878150, ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI5 17) chain A residue 1131 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI6 18) chain A residue 1278 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:15938644 source Swiss-Prot : SWS_FT_FI7 19) chain A residue 1124 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 1197 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 1270 type BINDING sequence D description BINDING => ECO:0000269|PubMed:20632993 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links