eF-site ID 4cde-F
PDB Code 4cde
Chain F

click to enlarge
Title Human DPP1 in complex with 4-amino-N-((1S)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Classification HYDROLASE
Compound DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
Source (CATC_HUMAN)
Sequence F:  PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGE
NGYFRIRRGTDECAIESIAVAATPIPKL
Description (1)  DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN (E.C.3.4.14.1)


Functional site

1) chain F
residue 379
type
ligand
sequence T
description BINDING SITE FOR RESIDUE U6B F 1440
source : AC2

2) chain F
residue 380
type
ligand
sequence N
description BINDING SITE FOR RESIDUE U6B F 1440
source : AC2

3) chain F
residue 381
type
ligand
sequence H
description BINDING SITE FOR RESIDUE U6B F 1440
source : AC2

4) chain F
residue 379-382
type binding
ligand U6B: 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE
sequence TNHA
description 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE binding site
source pdb_hetatom : U6B_4cde_F_1440

5) chain F
residue 374
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_D_1119

6) chain F
residue 376
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_D_1119

7) chain F
residue 378
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_D_1119


Display surface

Download
Links