eF-site ID 4cde-D
PDB Code 4cde
Chain D

click to enlarge
Title Human DPP1 in complex with 4-amino-N-((1S)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Classification HYDROLASE
Compound DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
Source (CATC_HUMAN)
Sequence D:  DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKV
VVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAF
FKYKKVTTYCNETMTGWVHDVLGRNWACFTGKKV
Description (1)  DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN (E.C.3.4.14.1)


Functional site

1) chain D
residue 1
type
ligand
sequence D
description BINDING SITE FOR RESIDUE U6B F 1440
source : AC2

2) chain D
residue 54
type
ligand
sequence L
description Binding site for Mono-Saccharide NAG B1367 bound to ASN B 252
source : AC6

3) chain D
residue 5
type
ligand
sequence N
description Binding site for Mono-Saccharide NAG D1119 bound to ASN D 5
source : AC7

4) chain D
residue 7
type
ligand
sequence T
description Binding site for Mono-Saccharide NAG D1119 bound to ASN D 5
source : AC7

5) chain D
residue 53-54
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence DL
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_B_1367

6) chain D
residue 1-3
type binding
ligand U6B: 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE
sequence DTP
description 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE binding site
source pdb_hetatom : U6B_4cde_F_1440

7) chain D
residue 64
type binding
ligand U6B: 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE
sequence Y
description 4-AZANYL-N-[(2S)-1-AZANYLIDENE-3-[4-(4-CYANOPHENYL)PHENYL]PROPAN-2-YL]OXANE-4-CARBOXAMIDE binding site
source pdb_hetatom : U6B_4cde_F_1440

8) chain D
residue 5
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_D_1119

9) chain D
residue 7
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4cde_D_1119


Display surface

Download
Links