eF-site ID 4cde-B
PDB Code 4cde
Chain B

click to enlarge
Title Human DPP1 in complex with 4-amino-N-((1S)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Classification HYDROLASE
Compound DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
Source (CATC_HUMAN)
Sequence B:  HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEA
RIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGK
YAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVG
GFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYH
H
Description (1)  DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN (E.C.3.4.14.1)


Functional site

1) chain B
residue 228-239
type prosite
ligand
sequence QASCGSCYSFAS
description Eukaryotic thiol (cysteine) proteases cysteine active site.Q-{V}-x-{DE}-[GE]-{F}-C-[YW]-{DN}-x-[STAGC]-[STAGCV].
source prosite : PS00139


Display surface

Download
Links