eF-site ID 4cck-C
PDB Code 4cck
Chain C

click to enlarge
Title 60S ribosomal protein L8 histidine hydroxylase (NO66) in complex with Mn(II) and N-oxalylglycine (NOG)
Classification OXIDOREDUCTASE
Compound BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66
Source (NO66_HUMAN)
Sequence C:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVAQL
TTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEP
KCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSL
ATTLYDKGLLLTKMPLAL
Description (1)  BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66 (E.C.1.14.11.-, 1.14.11.27)


Functional site

1) chain C
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

2) chain C
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

3) chain C
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

4) chain C
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

5) chain C
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

6) chain C
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

7) chain C
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

8) chain C
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

9) chain C
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

10) chain C
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

11) chain C
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

12) chain C
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

13) chain C
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

14) chain C
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

15) chain C
residue 505
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

16) chain C
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

17) chain C
residue 320-322
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GSM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

18) chain C
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

19) chain C
residue 501
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

20) chain C
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

21) chain C
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

22) chain C
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

23) chain C
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

24) chain C
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

25) chain C
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

26) chain C
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

27) chain C
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

28) chain C
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

29) chain C
residue 399
type binding
ligand OGA: N-OXALYLGLYCINE
sequence F
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

30) chain C
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

31) chain C
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

32) chain C
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

33) chain C
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

34) chain C
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

35) chain C
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903


Display surface

Download
Links