eF-site ID 4cck-ABCD
PDB Code 4cck
Chain A, B, C, D

click to enlarge
Title 60S ribosomal protein L8 histidine hydroxylase (NO66) in complex with Mn(II) and N-oxalylglycine (NOG)
Classification OXIDOREDUCTASE
Compound BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66
Source (NO66_HUMAN)
Sequence A:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNAQLT
TETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPK
CLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLA
TTLYDKGLLLTKMPLA
B:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNAQLT
TETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPK
CLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLA
TTLYDKGLLLTKMPLA
C:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVAQL
TTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEP
KCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSL
ATTLYDKGLLLTKMPLAL
D:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVAQL
TTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEP
KCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSL
ATTLYDKGLLLTKMPLALN
Description (1)  BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66 (E.C.1.14.11.-, 1.14.11.27)


Functional site

1) chain A
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

2) chain A
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

3) chain A
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

4) chain A
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

5) chain A
residue 337
type
ligand
sequence F
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

6) chain A
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

7) chain A
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

8) chain A
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

9) chain A
residue 357
type
ligand
sequence W
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

10) chain A
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

11) chain A
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

12) chain A
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

13) chain A
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

14) chain A
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

15) chain A
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

16) chain A
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

17) chain B
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

18) chain B
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 901
source : AC4

19) chain B
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN B 901
source : AC4

20) chain B
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 901
source : AC4

21) chain B
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

22) chain B
residue 337
type
ligand
sequence F
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

23) chain B
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

24) chain B
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

25) chain B
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

26) chain B
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

27) chain B
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

28) chain B
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA B 902
source : AC5

29) chain A
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

30) chain B
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

31) chain B
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

32) chain B
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

33) chain B
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

34) chain C
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

35) chain C
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

36) chain C
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 901
source : AC7

37) chain C
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

38) chain C
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

39) chain C
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

40) chain C
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

41) chain C
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

42) chain C
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

43) chain C
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA C 902
source : AC8

44) chain C
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

45) chain C
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

46) chain C
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

47) chain C
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

48) chain C
residue 505
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

49) chain D
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO C 903
source : AC9

50) chain D
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN D 901
source : BC1

51) chain D
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN D 901
source : BC1

52) chain D
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN D 901
source : BC1

53) chain D
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

54) chain D
residue 337
type
ligand
sequence F
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

55) chain D
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

56) chain D
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

57) chain D
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

58) chain D
residue 357
type
ligand
sequence W
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

59) chain D
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

60) chain D
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

61) chain D
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA D 902
source : BC2

62) chain C
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

63) chain D
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

64) chain D
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

65) chain D
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

66) chain D
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

67) chain D
residue 505
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO D 903
source : BC3

68) chain A
residue 320-322
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GSM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

69) chain A
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

70) chain A
residue 501
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

71) chain A
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

72) chain B
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

73) chain B
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

74) chain A
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

75) chain A
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

76) chain A
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

77) chain A
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

78) chain A
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

79) chain A
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

80) chain A
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

81) chain A
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

82) chain A
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

83) chain A
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

84) chain A
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

85) chain A
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

86) chain A
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

87) chain A
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

88) chain B
residue 320-321
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GS
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

89) chain B
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

90) chain B
residue 501-502
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence RA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

91) chain B
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

92) chain B
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

93) chain B
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

94) chain B
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

95) chain B
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

96) chain B
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

97) chain B
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

98) chain B
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

99) chain B
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

100) chain B
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

101) chain B
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

102) chain B
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

103) chain B
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_B_902

104) chain C
residue 320-322
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GSM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

105) chain C
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

106) chain C
residue 501
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

107) chain C
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

108) chain D
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

109) chain D
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_C_903

110) chain C
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

111) chain C
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

112) chain C
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

113) chain C
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

114) chain C
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

115) chain C
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

116) chain C
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

117) chain C
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

118) chain C
residue 399
type binding
ligand OGA: N-OXALYLGLYCINE
sequence F
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

119) chain C
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

120) chain C
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

121) chain C
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

122) chain C
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_C_902

123) chain C
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

124) chain C
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

125) chain D
residue 320-322
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GSM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

126) chain D
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

127) chain D
residue 501
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

128) chain D
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_D_903

129) chain D
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

130) chain D
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

131) chain D
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

132) chain D
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

133) chain D
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

134) chain D
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

135) chain D
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

136) chain D
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

137) chain D
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

138) chain D
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

139) chain D
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902

140) chain D
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_D_902


Display surface

Download
Links