eF-site ID 4cck-A
PDB Code 4cck
Chain A

click to enlarge
Title 60S ribosomal protein L8 histidine hydroxylase (NO66) in complex with Mn(II) and N-oxalylglycine (NOG)
Classification OXIDOREDUCTASE
Compound BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66
Source (NO66_HUMAN)
Sequence A:  MSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRR
LWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQH
LDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCP
QAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHY
DDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDD
LGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLS
TYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDY
MGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQR
AKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNAQLT
TETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPK
CLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLA
TTLYDKGLLLTKMPLA
Description (1)  BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE NO66 (E.C.1.14.11.-, 1.14.11.27)


Functional site

1) chain A
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

2) chain A
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

3) chain A
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 901
source : AC1

4) chain A
residue 328
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

5) chain A
residue 337
type
ligand
sequence F
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

6) chain A
residue 340
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

7) chain A
residue 342
type
ligand
sequence D
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

8) chain A
residue 355
type
ligand
sequence K
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

9) chain A
residue 357
type
ligand
sequence W
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

10) chain A
residue 405
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

11) chain A
residue 417
type
ligand
sequence H
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

12) chain A
residue 419
type
ligand
sequence T
description BINDING SITE FOR RESIDUE OGA A 902
source : AC2

13) chain A
residue 320
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

14) chain A
residue 321
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

15) chain A
residue 426
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

16) chain A
residue 501
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO A 903
source : AC3

17) chain A
residue 458
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO B 903
source : AC6

18) chain A
residue 320-322
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GSM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

19) chain A
residue 426
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

20) chain A
residue 501
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

21) chain A
residue 505
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_A_903

22) chain A
residue 328
type binding
ligand OGA: N-OXALYLGLYCINE
sequence Y
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

23) chain A
residue 330
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

24) chain A
residue 336-337
type binding
ligand OGA: N-OXALYLGLYCINE
sequence GF
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

25) chain A
residue 340
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

26) chain A
residue 342
type binding
ligand OGA: N-OXALYLGLYCINE
sequence D
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

27) chain A
residue 348
type binding
ligand OGA: N-OXALYLGLYCINE
sequence V
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

28) chain A
residue 355
type binding
ligand OGA: N-OXALYLGLYCINE
sequence K
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

29) chain A
residue 357
type binding
ligand OGA: N-OXALYLGLYCINE
sequence W
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

30) chain A
residue 405
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

31) chain A
residue 407
type binding
ligand OGA: N-OXALYLGLYCINE
sequence A
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

32) chain A
residue 417
type binding
ligand OGA: N-OXALYLGLYCINE
sequence H
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

33) chain A
residue 419
type binding
ligand OGA: N-OXALYLGLYCINE
sequence T
description N-OXALYLGLYCINE binding site
source pdb_hetatom : OGA_4cck_A_902

34) chain A
residue 454
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903

35) chain A
residue 458-459
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FM
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_4cck_B_903


Display surface

Download
Links