eF-site ID 4c6q-A PDB Code 4c6q Chain A click to enlarge Title Crystal structure of the dihydroorotase domain of human CAD C1613S mutant bound to substrate at pH 7.0 Classification HYDROLASE Compound CAD PROTEIN Source Homo sapiens (Human) (PYR1_HUMAN) Sequence A:  KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITM VCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASS ENAGTLGTVAGSAAGLXLYLNETFSELRLDSVVQWMEHFE TWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHISHVARKE EILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGE VRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR PPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRI FHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKV KGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQ LPP Description Functional site 1) chain A residue 1473 type sequence H description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 2) chain A residue 1475 type sequence R description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 3) chain A residue 1505 type sequence N description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 4) chain A residue 1562 type sequence T description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 5) chain A residue 1563 type sequence F description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 6) chain A residue 1590 type sequence H description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 7) chain A residue 1660 type sequence V description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 8) chain A residue 1661 type sequence R description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 9) chain A residue 1688 type sequence A description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 10) chain A residue 1690 type sequence H description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 11) chain A residue 1702 type sequence P description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 12) chain A residue 1703 type sequence G description BINDING SITE FOR RESIDUE ORO A 2823 source : AC1 13) chain A residue 1471 type sequence H description BINDING SITE FOR RESIDUE ZN A 2824 source : AC2 14) chain A residue 1473 type sequence H description BINDING SITE FOR RESIDUE ZN A 2824 source : AC2 15) chain A residue 1556 type sequence X description BINDING SITE FOR RESIDUE ZN A 2824 source : AC2 16) chain A residue 1686 type sequence D description BINDING SITE FOR RESIDUE ZN A 2824 source : AC2 17) chain A residue 1556 type sequence X description BINDING SITE FOR RESIDUE ZN A 2825 source : AC3 18) chain A residue 1590 type sequence H description BINDING SITE FOR RESIDUE ZN A 2825 source : AC3 19) chain A residue 1614 type sequence H description BINDING SITE FOR RESIDUE ZN A 2825 source : AC3 20) chain A residue 1471 type sequence H description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 21) chain A residue 1473 type sequence H description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 22) chain A residue 1475 type sequence R description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 23) chain A residue 1505 type sequence N description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 24) chain A residue 1556 type sequence X description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 25) chain A residue 1562 type sequence T description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 26) chain A residue 1563 type sequence F description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 27) chain A residue 1590 type sequence H description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 28) chain A residue 1614 type sequence H description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 29) chain A residue 1660 type sequence V description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 30) chain A residue 1661 type sequence R description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 31) chain A residue 1686 type sequence D description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 32) chain A residue 1688 type sequence A description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 33) chain A residue 1690 type sequence H description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 34) chain A residue 1702 type sequence P description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 35) chain A residue 1703 type sequence G description BINDING SITE FOR RESIDUE NCD A 2826 source : AC4 36) chain A residue 1586 type sequence P description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 37) chain A residue 1587 type sequence I description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 38) chain A residue 1608 type sequence R description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 39) chain A residue 1609 type sequence S description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 40) chain A residue 1610 type sequence V description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 41) chain A residue 1611 type sequence H description BINDING SITE FOR RESIDUE FMT A 2827 source : AC5 42) chain A residue 1470 type sequence V description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 43) chain A residue 1471 type sequence H description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 44) chain A residue 1503 type sequence M description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 45) chain A residue 1534 type sequence F description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 46) chain A residue 1588 type sequence V description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 47) chain A residue 1611 type sequence H description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 48) chain A residue 1613 type sequence S description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 49) chain A residue 1637 type sequence E description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 50) chain A residue 1740 type sequence F description BINDING SITE FOR RESIDUE FMT A 2828 source : AC6 51) chain A residue 1734 type sequence H description BINDING SITE FOR RESIDUE FMT A 2829 source : AC7 52) chain A residue 1734 type sequence H description BINDING SITE FOR RESIDUE FMT A 2829 source : AC7 53) chain A residue 1737 type sequence R description BINDING SITE FOR RESIDUE FMT A 2829 source : AC7 54) chain A residue 1737 type sequence R description BINDING SITE FOR RESIDUE FMT A 2829 source : AC7 55) chain A residue 1604 type sequence Q description BINDING SITE FOR RESIDUE FMT A 2830 source : AC8 56) chain A residue 1605 type sequence L description BINDING SITE FOR RESIDUE FMT A 2830 source : AC8 57) chain A residue 1630 type sequence R description BINDING SITE FOR RESIDUE FMT A 2830 source : AC8 58) chain A residue 1469-1477 type prosite sequence DVHVHLREP description DIHYDROOROTASE_1 Dihydroorotase signature 1. DVHVHLReP source prosite : PS00482 59) chain A residue 1684-1695 type prosite sequence ASDHAPHTLEEK description DIHYDROOROTASE_2 Dihydroorotase signature 2. ASDhAPHtleeK source prosite : PS00483 60) chain A residue 1686 type ACT_SITE sequence D description For DHOase activity => ECO:0000250|UniProtKB:P05020 source Swiss-Prot : SWS_FT_FI1 61) chain A residue 1471 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 62) chain A residue 1473 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 63) chain A residue 1590 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 64) chain A residue 1613 type BINDING sequence S description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 65) chain A residue 1614 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 66) chain A residue 1637 type BINDING sequence E description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 67) chain A residue 1686 type BINDING sequence D description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI2 68) chain A residue 1475 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6Q source Swiss-Prot : SWS_FT_FI3 69) chain A residue 1505 type BINDING sequence N description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6Q source Swiss-Prot : SWS_FT_FI3 70) chain A residue 1661 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6Q source Swiss-Prot : SWS_FT_FI3 71) chain A residue 1690 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6Q source Swiss-Prot : SWS_FT_FI3 72) chain A residue 1702 type BINDING sequence P description BINDING => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6Q source Swiss-Prot : SWS_FT_FI3 73) chain A residue 1556 type BINDING sequence X description via carbamate group => ECO:0000269|PubMed:24332717, ECO:0007744|PDB:4C6D source Swiss-Prot : SWS_FT_FI4 74) chain A residue 1556 type MOD_RES sequence X description N6-carboxylysine => ECO:0000269|PubMed:24332717 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links