eF-site ID 4c6j-A
PDB Code 4c6j
Chain A

click to enlarge
Title Crystal structure of the dihydroorotase domain of human CAD bound to substrate at pH 7.5
Classification HYDROLASE
Compound CAD PROTEIN
Source Homo sapiens (Human) (PYR1_HUMAN)
Sequence A:  KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITM
VCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASS
ENAGTLGTVAGSAAGLXLYLNETFSELRLDSVVQWMEHFE
TWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKE
EILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGE
VRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR
PPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRI
FHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKV
KGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQ
LPP
Description (1)  CAD PROTEIN (E.C.3.5.2.3)


Functional site

1) chain A
residue 1471
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 2823
source : AC1

2) chain A
residue 1473
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 2823
source : AC1

3) chain A
residue 1556
type
ligand
sequence X
description BINDING SITE FOR RESIDUE ZN A 2823
source : AC1

4) chain A
residue 1686
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN A 2823
source : AC1

5) chain A
residue 1556
type
ligand
sequence X
description BINDING SITE FOR RESIDUE ZN A 2824
source : AC2

6) chain A
residue 1590
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 2824
source : AC2

7) chain A
residue 1614
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 2824
source : AC2

8) chain A
residue 1471
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 2825
source : AC3

9) chain A
residue 1613
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 2825
source : AC3

10) chain A
residue 1637
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 2825
source : AC3

11) chain A
residue 1473
type
ligand
sequence H
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

12) chain A
residue 1475
type
ligand
sequence R
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

13) chain A
residue 1505
type
ligand
sequence N
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

14) chain A
residue 1562
type
ligand
sequence T
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

15) chain A
residue 1563
type
ligand
sequence F
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

16) chain A
residue 1590
type
ligand
sequence H
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

17) chain A
residue 1660
type
ligand
sequence V
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

18) chain A
residue 1661
type
ligand
sequence R
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

19) chain A
residue 1688
type
ligand
sequence A
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

20) chain A
residue 1690
type
ligand
sequence H
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

21) chain A
residue 1702
type
ligand
sequence P
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

22) chain A
residue 1703
type
ligand
sequence G
description BINDING SITE FOR RESIDUE DOR A 2826
source : AC4

23) chain A
residue 1586
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

24) chain A
residue 1587
type
ligand
sequence I
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

25) chain A
residue 1608
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

26) chain A
residue 1609
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

27) chain A
residue 1610
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

28) chain A
residue 1611
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMT A 2828
source : AC5

29) chain A
residue 1734
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMT A 2829
source : AC6

30) chain A
residue 1734
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMT A 2829
source : AC6

31) chain A
residue 1737
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 2829
source : AC6

32) chain A
residue 1737
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 2829
source : AC6

33) chain A
residue 1604
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMT A 2830
source : AC7

34) chain A
residue 1605
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FMT A 2830
source : AC7

35) chain A
residue 1630
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 2830
source : AC7

36) chain A
residue 1471
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

37) chain A
residue 1473
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

38) chain A
residue 1475
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence R
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

39) chain A
residue 1505
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence N
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

40) chain A
residue 1556
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence X
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

41) chain A
residue 1558
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence Y
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

42) chain A
residue 1562-1564
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence TFS
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

43) chain A
residue 1590
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

44) chain A
residue 1614
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

45) chain A
residue 1641
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

46) chain A
residue 1660-1662
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence VRP
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

47) chain A
residue 1686
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence D
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

48) chain A
residue 1688
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence A
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

49) chain A
residue 1690
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence H
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

50) chain A
residue 1702-1704
type binding
ligand NCD: N-CARBAMOYL-L-ASPARTATE
sequence PGF
description N-CARBAMOYL-L-ASPARTATE binding site
source pdb_hetatom : NCD_4c6j_A_2827

51) chain A
residue 1471
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence H
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

52) chain A
residue 1473
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence H
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

53) chain A
residue 1475
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence R
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

54) chain A
residue 1505
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence N
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

55) chain A
residue 1556
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence X
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

56) chain A
residue 1558
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence Y
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

57) chain A
residue 1562-1564
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence TFS
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

58) chain A
residue 1590
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence H
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

59) chain A
residue 1614
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence H
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

60) chain A
residue 1660-1662
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence VRP
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

61) chain A
residue 1686
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence D
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

62) chain A
residue 1688
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence A
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

63) chain A
residue 1690
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence H
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

64) chain A
residue 1701-1704
type binding
ligand DOR: (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID
sequence PPGF
description (4S)-2,6-DIOXOHEXAHYDROPYRIMIDINE-4-CARBOXYLIC ACID binding site
source pdb_hetatom : DOR_4c6j_A_2826

65) chain A
residue 1585-1588
type binding
ligand FMT: FORMIC ACID
sequence LPIV
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2828

66) chain A
residue 1608-1611
type binding
ligand FMT: FORMIC ACID
sequence RSVH
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2828

67) chain A
residue 1635
type binding
ligand FMT: FORMIC ACID
sequence T
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2828

68) chain A
residue 1739
type binding
ligand FMT: FORMIC ACID
sequence I
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2828

69) chain A
residue 1604
type binding
ligand FMT: FORMIC ACID
sequence Q
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2830

70) chain A
residue 1630
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2830

71) chain A
residue 1632
type binding
ligand FMT: FORMIC ACID
sequence L
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2830

72) chain A
residue 1733-1734
type binding
ligand FMT: FORMIC ACID
sequence HH
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2829

73) chain A
residue 1737-1738
type binding
ligand FMT: FORMIC ACID
sequence RR
description FORMIC ACID binding site
source pdb_hetatom : FMT_4c6j_A_2829


Display surface

Download
Links