eF-site ID 4bxf-B
PDB Code 4bxf
Chain B

click to enlarge
Title 60S ribosomal protein L27A histidine hydroxylase (MINA53 Y209C) in complex with MN(II), 2-oxoglutarate (2OG) and 60S ribosomal protein L27A (RPL27A G37C) peptide fragment
Classification OXIDOREDUCTASE/TRANSLATION
Compound BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE MINA
Source (RL27A_HUMAN)
Sequence B:  SALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKK
KVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWRI
QEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQL
EGEKHWRLYHPTVPLARECSVEAEERIGRPVHEFMLKPGD
LLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLD
TISGLVFDTAKEDVELRTGIPRQLLLQVESTTVATRRLSG
FLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL
STPGGKLPRLDSVVRLQFKDHIVLTVLPQEKMVYIYHSLK
NSRETHMMTEFHGLRFPLSHLDALKQIWNSPAISVKDLKL
TTDEEKESLVLSLWTECLIQVV
Description (1)  BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE MINA (E.C.1.14.11.-), 60S RIBOSOMAL PROTEIN L27A


Functional site

1) chain B
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

2) chain B
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

3) chain B
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

4) chain B
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

5) chain B
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

6) chain B
residue 194
type
ligand
sequence K
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

7) chain B
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

8) chain B
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

9) chain B
residue 255
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

10) chain B
residue 134
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

11) chain B
residue 167
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence Y
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

12) chain B
residue 169
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

13) chain B
residue 175-176
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence GL
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

14) chain B
residue 179
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

15) chain B
residue 181
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence D
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

16) chain B
residue 187
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence I
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

17) chain B
residue 194
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence K
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

18) chain B
residue 196
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence W
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

19) chain B
residue 234
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence F
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

20) chain B
residue 240
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

21) chain B
residue 242
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

22) chain B
residue 253
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

23) chain B
residue 255
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901


Display surface

Download
Links