eF-site ID 4bl1-A PDB Code 4bl1 Chain A click to enlarge Title Crystal structure of unphosphorylated Maternal Embryonic Leucine zipper Kinase (MELK) in complex with AMP-PNP Classification TRANSFERASE Compound MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE Source (MELK_HUMAN) Sequence A:  KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKI MDKNTLLPRIKTEIEALKNLRHQHICQLYHVLETANKIFM VLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVH SQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKSLAYAAPE LIQGKGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKI MRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHP WIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTM EDLISLWQYDHLTATYLLLLAKKARGKPVRLR Description Functional site 1) chain A residue 18 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 2) chain A residue 20 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 3) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 4) chain A residue 22 type sequence F description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 5) chain A residue 23 type sequence A description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 6) chain A residue 25 type sequence V description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 7) chain A residue 38 type sequence A description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 8) chain A residue 40 type sequence K description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 9) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 10) chain A residue 70 type sequence C description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 11) chain A residue 87 type sequence E description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 12) chain A residue 89 type sequence C description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 13) chain A residue 93 type sequence E description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 14) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 15) chain A residue 139 type sequence L description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 16) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 17) chain A residue 132 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 17 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 40 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 56 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:16216881 source Swiss-Prot : SWS_FT_FI3 21) chain A residue 171 type MOD_RES sequence S description Phosphoserine; by autocatalysis => ECO:0000269|PubMed:16216881 source Swiss-Prot : SWS_FT_FI6 22) chain A residue 253 type MOD_RES sequence S description Phosphoserine; by autocatalysis => ECO:0000269|PubMed:16216881 source Swiss-Prot : SWS_FT_FI6 23) chain A residue 17-40 type prosite sequence IGTGGFAKVKLACHILTGEMVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGTGGFAKVKlAchiltgem..........VAIK source prosite : PS00107 24) chain A residue 128-140 type prosite sequence YAHRDLKPENLLF description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. YaHrDLKpeNLLF source prosite : PS00108

Display surface Download Links