eF-site ID 4bfm-A PDB Code 4bfm Chain A click to enlarge Title The crystal structure of mouse PK38 Classification TRANSFERASE Compound MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE Source Mus musculus (Mouse) (MELK_MOUSE) Sequence A:  KDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKI MDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNK IFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVA YVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKCGSLA YAAPELIQGSEADVWSMGILLYVLMCGFLPFDDDNVMALY KKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLL NHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSR QTMEDLISSWQYDHLTATYLLLLAKKARLEHHH Description Functional site 1) chain A residue 17 type sequence I description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 2) chain A residue 18 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 3) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 4) chain A residue 20 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 5) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 6) chain A residue 22 type sequence F description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 7) chain A residue 23 type sequence A description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 8) chain A residue 25 type sequence V description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 9) chain A residue 38 type sequence A description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 10) chain A residue 40 type sequence K description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 11) chain A residue 70 type sequence C description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 12) chain A residue 87 type sequence E description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 13) chain A residue 89 type sequence C description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 14) chain A residue 93 type sequence E description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 15) chain A residue 139 type sequence L description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 16) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE ANP A 1000 source : AC1 17) chain A residue 15 type sequence E description BINDING SITE FOR RESIDUE SO4 A 2001 source : AC2 18) chain A residue 16 type sequence T description BINDING SITE FOR RESIDUE SO4 A 2001 source : AC2 19) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE SO4 A 2001 source : AC2 20) chain A residue 122 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 2001 source : AC2 21) chain A residue 68 type sequence H description BINDING SITE FOR RESIDUE SO4 A 2002 source : AC3 22) chain A residue 145 type sequence K description BINDING SITE FOR RESIDUE SO4 A 2002 source : AC3 23) chain A residue 105 type sequence S description BINDING SITE FOR RESIDUE SO4 A 2003 source : AC4 24) chain A residue 106 type sequence E description BINDING SITE FOR RESIDUE SO4 A 2003 source : AC4 25) chain A residue 107 type sequence E description BINDING SITE FOR RESIDUE SO4 A 2003 source : AC4 26) chain A residue 296 type sequence S description BINDING SITE FOR RESIDUE SO4 A 2004 source : AC5 27) chain A residue 297 type sequence S description BINDING SITE FOR RESIDUE SO4 A 2004 source : AC5 28) chain A residue 300 type sequence T description BINDING SITE FOR RESIDUE SO4 A 2004 source : AC5 29) chain A residue 121 type sequence A description BINDING SITE FOR RESIDUE SO4 A 2006 source : AC6 30) chain A residue 254 type sequence M description BINDING SITE FOR RESIDUE SO4 A 2006 source : AC6 31) chain A residue 273 type sequence W description BINDING SITE FOR RESIDUE SO4 A 2006 source : AC6 32) chain A residue 124 type sequence H description BINDING SITE FOR RESIDUE SO4 A 2007 source : AC7 33) chain A residue 188 type sequence S description BINDING SITE FOR RESIDUE SO4 A 2007 source : AC7 34) chain A residue 254 type sequence M description BINDING SITE FOR RESIDUE SO4 A 2007 source : AC7 35) chain A residue 56 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000250|UniProtKB:Q14680 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 132 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 17 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 40 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 17-40 type prosite sequence IGTGGFAKVKLACHVLTGEMVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGTGGFAKVKlAchvltgem..........VAIK source prosite : PS00107 40) chain A residue 128-140 type prosite sequence YAHRDLKPENLLF description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. YaHrDLKpeNLLF source prosite : PS00108 41) chain A residue 171 type MOD_RES sequence S description Phosphoserine; by autocatalysis => ECO:0000250|UniProtKB:Q14680 source Swiss-Prot : SWS_FT_FI5 42) chain A residue 253 type MOD_RES sequence S description Phosphoserine; by autocatalysis => ECO:0000250|UniProtKB:Q14680 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links