eF-site ID 4bff-K PDB Code 4bff Chain K click to enlarge Title Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus in the reduced form Classification OXIDOREDUCTASE Compound SUPEROXIDE REDUCTASE Source Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) (SOR_ARCFU) Sequence K:  ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHP NTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGP NTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEAT LSL Description Functional site 1) chain K residue 14 type sequence H description BINDING SITE FOR RESIDUE FE2 K 201 source : BC2 2) chain K residue 40 type sequence H description BINDING SITE FOR RESIDUE FE2 K 201 source : BC2 3) chain K residue 46 type sequence H description BINDING SITE FOR RESIDUE FE2 K 201 source : BC2 4) chain K residue 110 type sequence C description BINDING SITE FOR RESIDUE FE2 K 201 source : BC2 5) chain K residue 113 type sequence H description BINDING SITE FOR RESIDUE FE2 K 201 source : BC2 6) chain K residue 12 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 7) chain K residue 14 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 8) chain K residue 40 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 9) chain K residue 46 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 10) chain K residue 110 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 11) chain K residue 113 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links