eF-site ID 4bff-A PDB Code 4bff Chain A click to enlarge Title Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus in the reduced form Classification OXIDOREDUCTASE Compound SUPEROXIDE REDUCTASE Source Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) (SOR_ARCFU) Sequence A:  ELFQTADWKKEKHVPVIEVLRAEGGVVEVKVSVGKEIPHP NTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGP NTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEAT LSL Description Functional site 1) chain A residue 14 type sequence H description BINDING SITE FOR RESIDUE FE2 A 201 source : AC1 2) chain A residue 40 type sequence H description BINDING SITE FOR RESIDUE FE2 A 201 source : AC1 3) chain A residue 46 type sequence H description BINDING SITE FOR RESIDUE FE2 A 201 source : AC1 4) chain A residue 110 type sequence C description BINDING SITE FOR RESIDUE FE2 A 201 source : AC1 5) chain A residue 113 type sequence H description BINDING SITE FOR RESIDUE FE2 A 201 source : AC1 6) chain A residue 12 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 14 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 40 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 46 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 110 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 113 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links