eF-site ID 4b3s-N PDB Code 4b3s Chain N click to enlarge Title Crystal structure of the 30S ribosome in complex with compound 37 Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: THERMUS THERMOPHILUS HB8; Sequence N:  ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCR ICLRELAHKGQLPGVRKASW Description Functional site 1) chain N residue 23 type sequence C description BINDING SITE FOR RESIDUE ZN N 1061 source : SC4 2) chain N residue 26 type sequence C description BINDING SITE FOR RESIDUE ZN N 1061 source : SC4 3) chain N residue 28 type sequence R description BINDING SITE FOR RESIDUE ZN N 1061 source : SC4 4) chain N residue 39 type sequence C description BINDING SITE FOR RESIDUE ZN N 1061 source : SC4 5) chain N residue 42 type sequence C description BINDING SITE FOR RESIDUE ZN N 1061 source : SC4 6) chain N residue 23 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 7) chain N residue 26 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 8) chain N residue 39 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 9) chain N residue 42 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 10) chain N residue 22-44 type prosite sequence RCVRCGRARSVYRFFGLCRICLR description RIBOSOMAL_S14 Ribosomal protein S14 signature. R.CvrcgrarsvyrfFGLCRiCLR source prosite : PS00527

Display surface Download Links