eF-site ID 4b3s-M PDB Code 4b3s Chain M click to enlarge Title Crystal structure of the 30S ribosome in complex with compound 37 Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: THERMUS THERMOPHILUS HB8; Sequence M:  ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINP ATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRL MDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK KAPRK Description Functional site 1) chain M residue 100 type sequence Q description BINDING SITE FOR RESIDUE MG A 2664 source : MC9 2) chain M residue 19 type sequence T description BINDING SITE FOR RESIDUE MG M 1126 source : SC3 3) chain M residue 21 type sequence I description BINDING SITE FOR RESIDUE MG M 1126 source : SC3 4) chain M residue 22 type sequence Y description BINDING SITE FOR RESIDUE MG M 1126 source : SC3 5) chain M residue 24 type sequence I description BINDING SITE FOR RESIDUE MG M 1126 source : SC3 6) chain M residue 87-100 type prosite sequence RGLRHRRGLPVRGQ description RIBOSOMAL_S13_1 Ribosomal protein S13 signature. RGlRHrrGlpVRGQ source prosite : PS00646

Display surface Download Links