eF-site ID 4aw6-D
PDB Code 4aw6
Chain D

click to enlarge
Title Crystal structure of the human nuclear membrane zinc metalloprotease ZMPSTE24 (FACE1)
Classification HYDROLASE
Compound CAAX PRENYL PROTEASE 1 HOMOLOG
Source Homo sapiens (Human) (FACE1_HUMAN)
Sequence D:  LWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTT
HVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEG
TLILLFGGIPYLWRLSGRPEYEITQSLVFLLLATLFSALA
GLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCI
LLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYAD
YIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEG
SKRSSHSNAYFYGFFKNKRIVLFDTLLEQGCKNEEVLAVL
GHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELF
AAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRR
FEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFS
MWHYSHPPLLERLQALKT
Description (1)  CAAX PRENYL PROTEASE 1 HOMOLOG (E.C.3.4.24.84)


Functional site

1) chain D
residue 335
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 1472
source : AC5

2) chain D
residue 336
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1472
source : AC5

3) chain D
residue 339
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 1472
source : AC5

4) chain D
residue 415
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1472
source : AC5

5) chain D
residue 271
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PC1 D 1473
source : AC6

6) chain D
residue 336
type ACT_SITE
ligand
sequence E
description {ECO:0000269|PubMed:23539603}.
source Swiss-Prot : SWS_FT_FI9

7) chain D
residue 419
type ACT_SITE
ligand
sequence D
description Proton donor. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI10

8) chain D
residue 335
type METAL
ligand
sequence H
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI11

9) chain D
residue 339
type METAL
ligand
sequence H
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI11

10) chain D
residue 415
type METAL
ligand
sequence E
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI11

11) chain D
residue 19-39
type TRANSMEM
ligand
sequence IFGAVLLFSWTVYLWETFLAQ
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

12) chain D
residue 82-102
type TRANSMEM
ligand
sequence GLYSETEGTLILLFGGIPYLW
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

13) chain D
residue 124-144
type TRANSMEM
ligand
sequence LVFLLLATLFSALAGLPWSLY
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

14) chain D
residue 171-191
type TRANSMEM
ligand
sequence FVVTQCILLPVSSLLLYIIKI
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

15) chain D
residue 196-216
type TRANSMEM
ligand
sequence FFIYAWLFTLVVSLVLVTIYA
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

16) chain D
residue 348-368
type TRANSMEM
ligand
sequence NIIISQMNSFLCFFLFAVLIG
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

17) chain D
residue 383-405
type TRANSMEM
ligand
sequence PTLIGLLIIFQFIFSPYNEVLSF
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI12

18) chain D
residue 201
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence W
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

19) chain D
residue 205
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence L
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

20) chain D
residue 209-210
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence LV
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

21) chain D
residue 213
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence T
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

22) chain D
residue 271
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence F
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

23) chain D
residue 346
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence V
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

24) chain D
residue 349-350
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence II
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473

25) chain D
residue 353
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence Q
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_D_1473


Display surface

Download
Links