eF-site ID 4aw6-A
PDB Code 4aw6
Chain A

click to enlarge
Title Crystal structure of the human nuclear membrane zinc metalloprotease ZMPSTE24 (FACE1)
Classification HYDROLASE
Compound CAAX PRENYL PROTEASE 1 HOMOLOG
Source Homo sapiens (Human) (FACE1_HUMAN)
Sequence A:  GMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQ
RRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS
GLYSETEGTLILLFGGIPYLWRLSGRPEYEITQSLVFLLL
ATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIK
KFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSL
VLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPL
TKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEQGCK
NEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAV
LIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSF
CLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGF
PVSDWLFSMWHYSHPPLLERLQALKTM
Description (1)  CAAX PRENYL PROTEASE 1 HOMOLOG (E.C.3.4.24.84)


Functional site

1) chain A
residue 335
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1473
source : AC1

2) chain A
residue 336
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1473
source : AC1

3) chain A
residue 339
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1473
source : AC1

4) chain A
residue 415
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1473
source : AC1

5) chain A
residue 271
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PC1 A 1474
source : AC2

6) chain A
residue 336
type ACT_SITE
ligand
sequence E
description {ECO:0000269|PubMed:23539603}.
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 419
type ACT_SITE
ligand
sequence D
description Proton donor. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI2

8) chain A
residue 335
type METAL
ligand
sequence H
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI3

9) chain A
residue 339
type METAL
ligand
sequence H
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI3

10) chain A
residue 415
type METAL
ligand
sequence E
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI3

11) chain A
residue 19-39
type TRANSMEM
ligand
sequence IFGAVLLFSWTVYLWETFLAQ
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

12) chain A
residue 82-102
type TRANSMEM
ligand
sequence GLYSETEGTLILLFGGIPYLW
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

13) chain A
residue 124-144
type TRANSMEM
ligand
sequence LVFLLLATLFSALAGLPWSLY
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

14) chain A
residue 171-191
type TRANSMEM
ligand
sequence FVVTQCILLPVSSLLLYIIKI
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

15) chain A
residue 196-216
type TRANSMEM
ligand
sequence FFIYAWLFTLVVSLVLVTIYA
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

16) chain A
residue 348-368
type TRANSMEM
ligand
sequence NIIISQMNSFLCFFLFAVLIG
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

17) chain A
residue 383-405
type TRANSMEM
ligand
sequence PTLIGLLIIFQFIFSPYNEVLSF
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI4

18) chain A
residue 201-202
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence WL
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

19) chain A
residue 205
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence L
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

20) chain A
residue 209-210
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence LV
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

21) chain A
residue 213
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence T
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

22) chain A
residue 271
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence F
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

23) chain A
residue 346
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence V
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

24) chain A
residue 349-350
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence II
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

25) chain A
residue 353
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence Q
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474

26) chain A
residue 357
type binding
ligand PC1: 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
sequence F
description 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE binding site
source pdb_hetatom : PC1_4aw6_A_1474


Display surface

Download
Links