eF-site ID 4aw0-A PDB Code 4aw0 Chain A click to enlarge Title Human PDK1 Kinase Domain in Complex with Allosteric Compound PS182 Bound to the PIF-Pocket Classification TRANSFERASE Compound 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 Source Homo sapiens (Human) (PDPK1_HUMAN) Sequence A:  RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILE KRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEK LYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALE YLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPES KQARANXFVGTAQYVSPELLTEKSAXKSSDLWALGCIIYQ LVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVE KLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQT PPKLT Description Functional site 1) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 2) chain A residue 91 type sequence G description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 3) chain A residue 92 type sequence S description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 4) chain A residue 94 type sequence S description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 5) chain A residue 96 type sequence V description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 6) chain A residue 109 type sequence A description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 7) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 8) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 9) chain A residue 162 type sequence A description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 10) chain A residue 166 type sequence E description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 11) chain A residue 212 type sequence L description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 12) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE ATP A 500 source : AC1 13) chain A residue 76 type sequence K description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 14) chain A residue 127 type sequence V description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 15) chain A residue 128 type sequence T description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 16) chain A residue 131 type sequence R description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 17) chain A residue 148 type sequence T description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 18) chain A residue 149 type sequence F description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 19) chain A residue 150 type sequence Q description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 20) chain A residue 155 type sequence L description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 21) chain A residue 156 type sequence Y description BINDING SITE FOR RESIDUE MJF A 600 source : AC2 22) chain A residue 104 type sequence T description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 23) chain A residue 105 type sequence S description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 24) chain A residue 139 type sequence H description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 25) chain A residue 191 type sequence S description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 26) chain A residue 347 type sequence W description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 27) chain A residue 348 type sequence E description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 28) chain A residue 349 type sequence N description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 29) chain A residue 350 type sequence L description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 30) chain A residue 351 type sequence H description BINDING SITE FOR RESIDUE DMS A 700 source : AC3 31) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE MG A 800 source : AC4 32) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE MG A 800 source : AC4 33) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE MG A 850 source : AC5 34) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE MG A 850 source : AC5 35) chain A residue 242 type sequence F description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 36) chain A residue 243 type sequence V description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 37) chain A residue 244 type sequence G description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 38) chain A residue 246 type sequence A description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 39) chain A residue 249 type sequence V description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 40) chain A residue 283 type sequence R description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 41) chain A residue 287 type sequence E description BINDING SITE FOR RESIDUE DTD A 900 source : AC6 42) chain A residue 241 type MOD_RES sequence X description Phosphoserine; by autocatalysis => ECO:0000269|PubMed:10455013, ECO:0000269|PubMed:11481331, ECO:0000269|PubMed:15772071, ECO:0000269|PubMed:16780920, ECO:0000269|Ref.8 source Swiss-Prot : SWS_FT_FI4 43) chain A residue 304 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9Z2A0 source Swiss-Prot : SWS_FT_FI5 44) chain A residue 354 type MOD_RES sequence T description Phosphothreonine; by MELK => ECO:0000269|PubMed:22544756 source Swiss-Prot : SWS_FT_FI6 45) chain A residue 88-111 type prosite sequence LGEGSFSTVVLARELATSREYAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGSFSTVVlArelatsre..........YAIK source prosite : PS00107 46) chain A residue 201-213 type prosite sequence IIHRDLKPENILL description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. IiHrDLKpeNILL source prosite : PS00108 47) chain A residue 205 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 92 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12169624, ECO:0000269|PubMed:15741170, ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI2 49) chain A residue 111 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12169624, ECO:0000269|PubMed:15741170, ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI2 50) chain A residue 160 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12169624, ECO:0000269|PubMed:15741170, ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 166 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12169624, ECO:0000269|PubMed:15741170, ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI2 52) chain A residue 223 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12169624, ECO:0000269|PubMed:15741170, ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 209 type BINDING sequence E description BINDING => ECO:0000269|PubMed:22999883 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links