eF-site ID 4auq-E PDB Code 4auq Chain E click to enlarge Title Structure of BIRC7-UbcH5b-Ub complex. Classification LIGASE/LIGASE/SIGNALLING PROTEIN Compound UBIQUITIN-CONJUGATING ENZYME E2 D2 Source (UBC_HUMAN) Sequence E:  QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQL CPICRAPVRSRVRTFLS Description Functional site 1) chain E residue 252 type sequence C description BINDING SITE FOR RESIDUE ZN E 1299 source : AC3 2) chain E residue 255 type sequence C description BINDING SITE FOR RESIDUE ZN E 1299 source : AC3 3) chain E residue 272 type sequence C description BINDING SITE FOR RESIDUE ZN E 1299 source : AC3 4) chain E residue 275 type sequence C description BINDING SITE FOR RESIDUE ZN E 1299 source : AC3 5) chain E residue 267 type sequence C description BINDING SITE FOR RESIDUE ZN E 1300 source : AC4 6) chain E residue 269 type sequence H description BINDING SITE FOR RESIDUE ZN E 1300 source : AC4 7) chain E residue 282 type sequence C description BINDING SITE FOR RESIDUE ZN E 1300 source : AC4 8) chain E residue 285 type sequence C description BINDING SITE FOR RESIDUE ZN E 1300 source : AC4

Display surface Download Links